PSAD2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PSAD2_ARATH
• UniProt AC: Q9SA56
• Protein Name: Photosystem I reaction center subunit II-2, chloroplastic
• Gene Name: PSAD2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 204
• Subcellular Localization: Plastid, chloroplast thylakoid membrane; Peripheral membrane protein; Stromal side.
• Protein Description: PSAD can form complexes with ferredoxin and ferredoxin-oxidoreductase in photosystem I (PS I) reaction center. PSAD may encode the ferredoxin-docking protein (By similarity)..
• Protein Sequence: MATQAAGIFSPAITTTTSAVKKLHLFSSSHRPKSLSFTKTAIRAEKTESSSAAPAVKEAPVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGLNMRSIGKNVSPIEVKFTGKQSYDL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	IFSPAITTTTSAVKK CCCCCEECCHHHHHH	23.20	25368622
16	Phosphorylation	FSPAITTTTSAVKKL CCCCEECCHHHHHHH	15.31	25368622
17	Phosphorylation	SPAITTTTSAVKKLH CCCEECCHHHHHHHH	16.76	25368622
18	Phosphorylation	PAITTTTSAVKKLHL CCEECCHHHHHHHHH	29.04	25368622
36	Phosphorylation	SHRPKSLSFTKTAIR CCCCCCCCEECHHHH	37.65	19880383
47	Phosphorylation	TAIRAEKTESSSAAP HHHHHHHCCCCCCCC	32.38	19376835
49	Phosphorylation	IRAEKTESSSAAPAV HHHHHCCCCCCCCCC	34.52	19880383
50	Phosphorylation	RAEKTESSSAAPAVK HHHHCCCCCCCCCCC	20.12	19880383
64	Phosphorylation	KEAPVGFTPPQLDPN CCCCCCCCCCCCCCC	28.29	22092075
72	Phosphorylation	PPQLDPNTPSPIFAG CCCCCCCCCCCCCCC	30.45	27029354
74	Phosphorylation	QLDPNTPSPIFAGST CCCCCCCCCCCCCCC	28.70	27029354
80	Phosphorylation	PSPIFAGSTGGLLRK CCCCCCCCCCCHHHH	22.05	27029354
81	Phosphorylation	SPIFAGSTGGLLRKA CCCCCCCCCCHHHHC	34.06	27029354
110	Phosphorylation	EQIFEMPTGGAAIMR HHEEECCCCCCHHHC	47.11	22092075
145	Phosphorylation	LRSKYKITYQFYRVF HHHCEEEEEEEEEEC	13.71	29654922
190	Phosphorylation	RSIGKNVSPIEVKFT CCCCCCCCCEEEEEE	29.56	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PSAD2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PSAD2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PSAD2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CUT1C_ARATH	AT1G52220	physical	18813226
CDC23_ARATH	APC8	physical	21798944
KNAT1_ARATH	KNAT1	physical	21798944
BOI_ARATH	RING	physical	21798944
CLAH2_ARATH	AT3G08530	physical	21798944
HS157_ARATH	AT5G37670	physical	21798944
BH027_ARATH	AT4G29930	physical	21798944
TCP13_ARATH	PTF1	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks.";
Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.;
Plant Physiol. 150:889-903(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-47, AND MASSSPECTROMETRY.
PubMed: 19376835