PSA1B_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PSA1B_ARATH
• UniProt AC: O23712
• Protein Name: Proteasome subunit alpha type-1-B
• Gene Name: PAF2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 277
• Subcellular Localization: Cytoplasm. Nucleus.
• Protein Description: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. May play a role in thiol biosynthesis and arsenic tolerance in association with PAF1/ARS5..
• Protein Sequence: MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQRKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFESFQESSKEDLIKDAIMAIRETLQGETLKSSLCTVSVLGVDEPFHFLDQESIQKVIDTFEKVPEEEEDAGEGEAEPEAAPGAAGTGEQGGSGDQDVAPMEI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MFRNQYDT -------CCCCCCCC	6.85	20516081
90	Phosphorylation	VLSRYMRSESINHSF HHHHHHHCCCCCCCE	21.11	23111157
92	Phosphorylation	SRYMRSESINHSFTY HHHHHCCCCCCCEEE	29.91	19880383
96	Phosphorylation	RSESINHSFTYESPL HCCCCCCCEEECCCC	18.13	27643528
98	Phosphorylation	ESINHSFTYESPLPV CCCCCCEEECCCCCC	29.42	27643528
99	Phosphorylation	SINHSFTYESPLPVG CCCCCEEECCCCCCE	16.64	27643528
101	Phosphorylation	NHSFTYESPLPVGRL CCCEEECCCCCCEEE	22.71	27643528

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PSA1B_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PSA1B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PSA1B_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GCA2_ARATH	GAMMA CA2	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.