dbPTM

PRR15_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PRR15_HUMAN
UniProt AC	Q8IV56
Protein Name	Proline-rich protein 15
Gene Name	PRR15
Organism	Homo sapiens (Human).
Sequence Length	129
Subcellular Localization
Protein Description	May have a role in proliferation and/or differentiation..
Protein Sequence	MADSGDAGSSGPWWKSLTNSRKKSKEAAVGVPPPAQPAPGEPTPPAPPSPDWTSSSRENQHPNLLGGAGEPPKPDKLYGDKSGSSRRNLKISRSGRFKEKRKVRATLLPEAGRSPEEAGFPGDPHEDKQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MADSGDAGSSG ----CCCCCCCCCCC	29.09	24719451
9	Phosphorylation	ADSGDAGSSGPWWKS CCCCCCCCCCHHHHH	33.57	24719451
16	Phosphorylation	SSGPWWKSLTNSRKK CCCHHHHHHHCCCHH	27.06	23911959
20	Phosphorylation	WWKSLTNSRKKSKEA HHHHHHCCCHHHHHH	40.00	23911959
24	Phosphorylation	LTNSRKKSKEAAVGV HHCCCHHHHHHHCCC	38.47	-
43	Phosphorylation	QPAPGEPTPPAPPSP CCCCCCCCCCCCCCC	37.29	23312004
49	Phosphorylation	PTPPAPPSPDWTSSS CCCCCCCCCCCCCCC	34.14	28355574
53	Phosphorylation	APPSPDWTSSSRENQ CCCCCCCCCCCCCCC	26.55	30206219
54	Phosphorylation	PPSPDWTSSSRENQH CCCCCCCCCCCCCCC	23.28	30206219
55	Phosphorylation	PSPDWTSSSRENQHP CCCCCCCCCCCCCCC	26.49	30206219
56	Phosphorylation	SPDWTSSSRENQHPN CCCCCCCCCCCCCCC	43.30	30206219
92	Phosphorylation	SRRNLKISRSGRFKE CCCCCCCCCCCCCHH	20.85	24719451
94	Phosphorylation	RNLKISRSGRFKEKR CCCCCCCCCCCHHHH	27.77	28102081
106	Phosphorylation	EKRKVRATLLPEAGR HHHHHHEEECCCCCC	20.47	27251275
114	Phosphorylation	LLPEAGRSPEEAGFP ECCCCCCCHHHHCCC	35.43	26657352

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PRR15_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PRR15_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PRR15_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PRR15_HUMAN

Related Literatures of Post-Translational Modification