| UniProt ID | PRP1_HUMAN | |
|---|---|---|
| UniProt AC | P04280 | |
| Protein Name | Basic salivary proline-rich protein 1 | |
| Gene Name | PRB1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 392 | |
| Subcellular Localization | Secreted . | |
| Protein Description | ||
| Protein Sequence | MLLILLSVALLALSSAQNLNEDVSQEESPSLIAGNPQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPQQGGNRPQGPPPPGKPQGPPPQGDKSRSPQSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPAQGGSKSQSARSPPGKPQGPPQQEGNNPQGPPPPAGGNPQQPQAPPAGQPQGPPRPPQGGRPSRPPQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Pyrrolidone_carboxylic_acid | LLALSSAQNLNEDVS HHHHHHHHCCCCCCC | 57.82 | - | |
| 17 | Pyrrolidone_carboxylic_acid | LLALSSAQNLNEDVS HHHHHHHHCCCCCCC | 57.82 | 20879038 | |
| 17 | Pyrrolidone_carboxylic_acid | LLALSSAQNLNEDVS HHHHHHHHCCCCCCC | 57.82 | 20879038 | |
| 24 | Phosphorylation | QNLNEDVSQEESPSL HCCCCCCCCCCCCCH | 44.17 | 3521730 | |
| 40 | Phosphorylation | AGNPQGPSPQGGNKP CCCCCCCCCCCCCCC | 36.36 | 20879038 | |
| 40 | O-linked_Glycosylation | AGNPQGPSPQGGNKP CCCCCCCCCCCCCCC | 36.36 | 20879038 | |
| 87 | O-linked_Glycosylation | PPPQGDKSRSPRSPP CCCCCCCCCCCCCCC | 42.61 | 20879038 | |
| 87 | Phosphorylation | PPPQGDKSRSPRSPP CCCCCCCCCCCCCCC | 42.61 | 19651622 | |
| 89 | Phosphorylation | PQGDKSRSPRSPPGK CCCCCCCCCCCCCCC | 31.58 | 19651622 | |
| 92 | Phosphorylation | DKSRSPRSPPGKPQG CCCCCCCCCCCCCCC | 38.54 | 19651622 | |
| 150 | O-linked_Glycosylation | PQGDKSQSPRSPPGK CCCCCCCCCCCCCCC | 29.40 | 20879038 | |
| 150 | Phosphorylation | PQGDKSQSPRSPPGK CCCCCCCCCCCCCCC | 29.40 | 6089212 | |
| 153 | Phosphorylation | DKSQSPRSPPGKPQG CCCCCCCCCCCCCCC | 38.54 | 21299198 | |
| 211 | Phosphorylation | PQGDKSQSPRSPPGK CCCCCCCCCCCCCCC | 29.40 | 6089212 | |
| 214 | Phosphorylation | DKSQSPRSPPGKPQG CCCCCCCCCCCCCCC | 38.54 | 21299198 | |
| 330 | O-linked_Glycosylation | GPPAQGGSKSQSARS CCCCCCCCCCCCCCC | 35.64 | - | |
| 330 | Phosphorylation | GPPAQGGSKSQSARS CCCCCCCCCCCCCCC | 35.64 | 24505115 | |
| 388 | Phosphorylation | PPQGGRPSRPPQ--- CCCCCCCCCCCC--- | 56.93 | 21299198 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRP1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRP1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UBQL1_HUMAN | UBQLN1 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| O-linked Glycosylation | |
| Reference | PubMed |
| "Finding new posttranslational modifications in salivary proline-richproteins."; Vitorino R., Alves R., Barros A., Caseiro A., Ferreira R., Lobo M.C.,Bastos A., Duarte J., Carvalho D., Santos L.L., Amado F.L.; Proteomics 10:3732-3742(2010). Cited for: GLYCOSYLATION AT SER-40; SER-87 AND SER-150, PHOSPHORYLATION ATSER-40; SER-92 AND SER-150, PYROGLUTAMATE FORMATION AT GLN-17, MASSSPECTROMETRY, AND VARIANTS ALLELE M AND S AND CLONE CP-5. | |
| Phosphorylation | |
| Reference | PubMed |
| "Finding new posttranslational modifications in salivary proline-richproteins."; Vitorino R., Alves R., Barros A., Caseiro A., Ferreira R., Lobo M.C.,Bastos A., Duarte J., Carvalho D., Santos L.L., Amado F.L.; Proteomics 10:3732-3742(2010). Cited for: GLYCOSYLATION AT SER-40; SER-87 AND SER-150, PHOSPHORYLATION ATSER-40; SER-92 AND SER-150, PYROGLUTAMATE FORMATION AT GLN-17, MASSSPECTROMETRY, AND VARIANTS ALLELE M AND S AND CLONE CP-5. | |