| UniProt ID | PROF5_ARATH | |
|---|---|---|
| UniProt AC | Q9FE63 | |
| Protein Name | Profilin-5 | |
| Gene Name | PRO5 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 131 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG (By similarity).. | |
| Protein Sequence | MSWQTYVDDHLMCDVAGNRLTAAAILGQDGSVWAQSNNFPQVKPEEIQGIKDDFTTPGTLAPTGLFLGGNKYMVIQGEPNAVIRGKKGAGGVTIKKTTLALVFGIYDEPMTPGQCNMVVENLGEYLIESGL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of PROF5_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PROF5_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PROF5_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PROF5_ARATH !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...