UniProt ID | PRLHR_HUMAN | |
---|---|---|
UniProt AC | P49683 | |
Protein Name | Prolactin-releasing peptide receptor | |
Gene Name | PRLHR | |
Organism | Homo sapiens (Human). | |
Sequence Length | 370 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
Protein Description | Receptor for prolactin-releasing peptide (PrRP). Implicated in lactation, regulation of food intake and pain-signal processing.. | |
Protein Sequence | MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPHGQNMTVSVVI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | N-linked_Glycosylation | PAVTTPANQSAEASA CCCCCCCCCCCHHHC | 37.23 | UniProtKB CARBOHYD | |
36 | N-linked_Glycosylation | SAEASAGNGSVAGAD CCHHHCCCCCCCCCC | 39.00 | UniProtKB CARBOHYD | |
120 | Phosphorylation | CVPLTLAYAFEPRGW HHCHHHHHHCCCCCE | 18.22 | 22817900 | |
244 | Phosphorylation | PLLVILLSYVRVSVK HHHHHHHHHHHHHHH | 20.38 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRLHR_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRLHR_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRLHR_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GRIP1_HUMAN | GRIP1 | physical | 11641419 | |
PICK1_HUMAN | PICK1 | physical | 11641419 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...