PRE6_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PRE6_ARATH
• UniProt AC: Q8GW32
• Protein Name: Transcription factor PRE6
• Gene Name: PRE6
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 94
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Atypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex..
• Protein Sequence: MSSRRSSRSRQSGSSRISDDQISDLVSKLQHLIPELRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLASTDDNSAEAAIIRSLLNY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PRE6_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PRE6_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PRE6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PRE6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HFR1_ARATH	HFR1	physical	16786307

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.