UniProt ID | PP2BA_RAT | |
---|---|---|
UniProt AC | P63329 | |
Protein Name | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform | |
Gene Name | Ppp3ca | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 521 | |
Subcellular Localization |
Cytoplasm . Cell membrane Peripheral membrane protein . Cell membrane, sarcolemma . Cytoplasm, myofibril, sarcomere, Z line . Cell projection, dendritic spine . Colocalizes with ACTN1 and MYOZ2 at the Z line in heart and skeletal muscle (PubMed:111 |
|
Protein Description | Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals. [PubMed: 1322410] | |
Protein Sequence | MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSEPKAIDP ------CCCCCCCCC | 63.71 | - | |
10 | Acetylation | EPKAIDPKLSTTDRV CCCCCCCCCCCCCCE | 51.85 | 22902405 | |
32 | Ubiquitination | PSHRLTAKEVFDNDG CCCCCCHHHHCCCCC | 49.53 | - | |
32 | Acetylation | PSHRLTAKEVFDNDG CCCCCCHHHHCCCCC | 49.53 | 22902405 | |
40 | Acetylation | EVFDNDGKPRVDILK HHCCCCCCCHHHHHH | 32.30 | 22902405 | |
47 | Acetylation | KPRVDILKAHLMKEG CCHHHHHHHHHHHCC | 33.81 | 22902405 | |
107 | Phosphorylation | KLFEVGGSPANTRYL HHHCCCCCCCCCEEE | 18.21 | 25403869 | |
111 | Phosphorylation | VGGSPANTRYLFLGD CCCCCCCCEEEECCC | 23.85 | 25403869 | |
224 | Nitration | RFKEPPAYGPMCDIL HCCCCCCCCCCCCEE | 27.77 | - | |
224 | Nitrated tyrosine | RFKEPPAYGPMCDIL HCCCCCCCCCCCCEE | 27.77 | - | |
228 | S-nitrosocysteine | PPAYGPMCDILWSDP CCCCCCCCCEEECCC | 3.11 | - | |
228 | S-nitrosylation | PPAYGPMCDILWSDP CCCCCCCCCEEECCC | 3.11 | 16418269 | |
258 | Phosphorylation | NTVRGCSYFYSYPAV CCCCCCCHHHCCHHH | 15.60 | - | |
260 | Phosphorylation | VRGCSYFYSYPAVCD CCCCCHHHCCHHHHH | 10.08 | - | |
318 | Ubiquitination | YLDVYNNKAAVLKYE EEHHCCCCEEEEEEE | 33.80 | - | |
323 | Ubiquitination | NNKAAVLKYENNVMN CCCEEEEEEECCEEC | 43.87 | - | |
411 | Phosphorylation | GKMARVFSVLREESE HHHHHHHHHHHHHCC | 19.86 | 19608982 | |
427 | Phosphorylation | VLTLKGLTPTGMLPS EEEECCCCCCCCCCC | 27.72 | 25403869 | |
429 | Phosphorylation | TLKGLTPTGMLPSGV EECCCCCCCCCCCCC | 29.95 | 25403869 | |
434 | Phosphorylation | TPTGMLPSGVLSGGK CCCCCCCCCCCCCCC | 37.26 | 25403869 | |
438 | Phosphorylation | MLPSGVLSGGKQTLQ CCCCCCCCCCCHHHH | 42.99 | 25403869 | |
452 (in isoform 2) | Phosphorylation | - | 2.58 | 27115346 | |
458 (in isoform 2) | Phosphorylation | - | 4.16 | 27115346 | |
459 | Ubiquitination | IEADEAIKGFSPQHK HHHHHHHCCCCCCCC | 62.03 | - | |
459 (in isoform 2) | Phosphorylation | - | 62.03 | 27115346 | |
462 | Phosphorylation | DEAIKGFSPQHKITS HHHHCCCCCCCCCCC | 32.11 | 28432305 | |
469 | Phosphorylation | SPQHKITSFEEAKGL CCCCCCCCHHHHCCH | 33.85 | 25403869 | |
492 | Phosphorylation | PRRDAMPSDANLNSI CCCCCCCCCCCHHHH | 35.95 | 23984901 | |
498 | Phosphorylation | PSDANLNSINKALAS CCCCCHHHHHHHHHH | 30.61 | 23984901 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP2BA_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP2BA_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...