UniProt ID | PP2A1_ARATH | |
---|---|---|
UniProt AC | Q07099 | |
Protein Name | Serine/threonine-protein phosphatase PP2A-1 catalytic subunit | |
Gene Name | PP2A1 {ECO:0000303|PubMed:17368080} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 306 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | ||
Protein Sequence | MPLNGDLDRQIEQLMECKPLGEADVKILCDQAKAILVEEYNVQPVKCPVTVCGDIHGQFYDLIELFRIGGNAPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRDRLTILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRSLDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIATQFNHNNGLSLISRAHQLVMEGYNWCQEKNVVTVFSAPNYCYRCGNMAAILEIGEKMEQNFLQFDPAPRQVEPDTTRKTPDYFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
306 | Methylation | RKTPDYFL------- CCCCCCCC------- | 5.81 | 28741704 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PP2A1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP2A1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP2A1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CTR1_ARATH | CTR1 | physical | 12787251 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...