| UniProt ID | PORIM_HUMAN | |
|---|---|---|
| UniProt AC | Q8N131 | |
| Protein Name | Porimin | |
| Gene Name | TMEM123 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 208 | |
| Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
| Protein Description | Implicated in oncotic cell death, characterized by cell swelling, organelle swelling, vacuolization and increased membrane permeability.. | |
| Protein Sequence | MGLGARGAWAALLLGTLQVLALLGAAHESAAMAASANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTAASNTTTPGMVSTNMTSTTLKSTPKTTSVSQNTSQISTSTMTVTHNSSVTSAASSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRGIRYRTIDEHDAII | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 46 | N-linked_Glycosylation | ENSGLPHNSSANSTE CCCCCCCCCCCCCCC | 35.40 | UniProtKB CARBOHYD | |
| 50 | N-linked_Glycosylation | LPHNSSANSTETLQH CCCCCCCCCCCCCCC | 51.95 | UniProtKB CARBOHYD | |
| 64 | N-linked_Glycosylation | HVPSDHTNETSNSTV CCCCCCCCCCCCCCC | 47.32 | UniProtKB CARBOHYD | |
| 68 | N-linked_Glycosylation | DHTNETSNSTVKPPT CCCCCCCCCCCCCCC | 49.47 | UniProtKB CARBOHYD | |
| 83 | N-linked_Glycosylation | SVASDSSNTTVTTMK CCCCCCCCCEEEECC | 43.66 | UniProtKB CARBOHYD | |
| 96 | N-linked_Glycosylation | MKPTAASNTTTPGMV CCCCCCCCCCCCCEE | 36.40 | UniProtKB CARBOHYD | |
| 98 | Phosphorylation | PTAASNTTTPGMVST CCCCCCCCCCCEEEE | 34.93 | 22210691 | |
| 106 | N-linked_Glycosylation | TPGMVSTNMTSTTLK CCCEEEECCCCCCCC | 24.99 | UniProtKB CARBOHYD | |
| 114 | Phosphorylation | MTSTTLKSTPKTTSV CCCCCCCCCCCCCCC | 53.72 | 30576142 | |
| 124 | N-linked_Glycosylation | KTTSVSQNTSQISTS CCCCCCCCCCEEEEC | 33.90 | UniProtKB CARBOHYD | |
| 136 | Phosphorylation | STSTMTVTHNSSVTS EECEEEEECCCCCHH | 13.23 | 30576142 | |
| 138 | N-linked_Glycosylation | STMTVTHNSSVTSAA CEEEEECCCCCHHCC | 26.98 | UniProtKB CARBOHYD | |
| 146 | Phosphorylation | SSVTSAASSVTITTT CCCHHCCEEEEEEEE | 25.67 | 30576142 | |
| 149 | O-linked_Glycosylation | TSAASSVTITTTMHS HHCCEEEEEEEEECC | 17.98 | OGP | |
| 184 | Phosphorylation | LGVLSILYIGCKMYY HHHHHHHHHHHHHHH | 8.13 | - | |
| 190 | Phosphorylation | LYIGCKMYYSRRGIR HHHHHHHHHHCCCCC | 5.47 | 27259358 | |
| 191 | Phosphorylation | YIGCKMYYSRRGIRY HHHHHHHHHCCCCCC | 7.69 | - | |
| 192 | Phosphorylation | IGCKMYYSRRGIRYR HHHHHHHHCCCCCCE | 9.67 | 24719451 | |
| 198 | Phosphorylation | YSRRGIRYRTIDEHD HHCCCCCCEEECCCC | 15.36 | 24702127 | |
| 200 | Phosphorylation | RRGIRYRTIDEHDAI CCCCCCEEECCCCCC | 24.68 | 28450419 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PORIM_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PORIM_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PORIM_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| WDFY1_HUMAN | WDFY1 | physical | 26186194 | |
| WDFY1_HUMAN | WDFY1 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
