| UniProt ID | PLPP4_HUMAN | |
|---|---|---|
| UniProt AC | Q5VZY2 | |
| Protein Name | Phospholipid phosphatase 4 {ECO:0000312|HGNC:HGNC:23531} | |
| Gene Name | PLPP4 {ECO:0000312|HGNC:HGNC:23531} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 271 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | Displays magnesium-independent phosphatidate phosphatase activity in vitro. Catalyzes the conversion of phosphatidic acid to diacylglycerol.. | |
| Protein Sequence | MRELAIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFLTPLAVICVVKIIRRTDKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDGVMNSEMHCTGDPDLVSEGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWRLCAAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQHYPPLANTACHKPYVSLRVPASLKKEERPTADSAPSLPLEGITEGPV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 195 | Phosphorylation | CAMMIALSRMCDYKH HHHHHHHHHHCCCCH | 24719451 | ||
| 238 | Phosphorylation | NTACHKPYVSLRVPA CCCCCCCEEEEECCC | 28176486 | ||
| 240 | Phosphorylation | ACHKPYVSLRVPASL CCCCCEEEEECCCCC | 28176486 | ||
| 254 | Phosphorylation | LKKEERPTADSAPSL CCCCCCCCCCCCCCC | 29514088 | ||
| 257 | Phosphorylation | EERPTADSAPSLPLE CCCCCCCCCCCCCCC | 29514088 | ||
| 260 | Phosphorylation | PTADSAPSLPLEGIT CCCCCCCCCCCCCCC | 29514088 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PLPP4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PLPP4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PLPP4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PLPP4_HUMAN | PPAPDC1A | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...