| UniProt ID | PLGF_HUMAN | |
|---|---|---|
| UniProt AC | P49763 | |
| Protein Name | Placenta growth factor | |
| Gene Name | PGF | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 221 | |
| Subcellular Localization | Secreted. The three isoforms are secreted but PlGF-2 appears to remain cell attached unless released by heparin. | |
| Protein Description | Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth.. | |
| Protein Sequence | MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 33 | N-linked_Glycosylation | QWALSAGNGSSEVEV HHHCCCCCCCCCEEE | 47.06 | UniProtKB CARBOHYD | |
| 101 | N-linked_Glycosylation | CVPVETANVTMQLLK EEEEECCCEEEEEEE | 36.89 | UniProtKB CARBOHYD | |
| 116 | Phosphorylation | IRSGDRPSYVELTFS CCCCCCCCEEEEEEE | 42.58 | - | |
| 117 | Phosphorylation | RSGDRPSYVELTFSQ CCCCCCCEEEEEEEC | 10.71 | 24719451 | |
| 121 | Phosphorylation | RPSYVELTFSQHVRC CCCEEEEEEECCEEE | 14.03 | 24719451 | |
| 158 (in isoform 3-1) | O-linked_Glycosylation | - | 37.80 | OGP |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PLGF_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PLGF_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PLGF_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| VEGFA_HUMAN | VEGFA | physical | 12086892 | |
| PLGF_HUMAN | PGF | physical | 12086892 | |
| PLGF_HUMAN | PGF | physical | 1924389 | |
| VEGFA_HUMAN | VEGFA | physical | 25241761 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
