dbPTM

PLF4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PLF4_HUMAN
UniProt AC	P02776
Protein Name	Platelet factor 4
Gene Name	PF4
Organism	Homo sapiens (Human).
Sequence Length	101
Subcellular Localization	Secreted .
Protein Description	Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form..
Protein Sequence	MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
56	Phosphorylation	QVRPRHITSLEVIKA CCCCCEECEEEEECC	22.57	28270605
57	Phosphorylation	VRPRHITSLEVIKAG CCCCEECEEEEECCC	23.17	28270605

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PLF4_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PLF4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PLF4_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRBM_HUMAN	THBD	physical	9395524
PROC_HUMAN	PROC	physical	9395524
PLF4_HUMAN	PF4	physical	8031770
LDLR_HUMAN	LDLR	physical	11986215
PLF4_HUMAN	PF4	physical	7547867
SDF1_HUMAN	CXCL12	physical	10233851
PLF4_HUMAN	PF4	physical	7835432

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PLF4_HUMAN

Related Literatures of Post-Translational Modification