UniProt ID | PLF4_HUMAN | |
---|---|---|
UniProt AC | P02776 | |
Protein Name | Platelet factor 4 | |
Gene Name | PF4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 101 | |
Subcellular Localization | Secreted . | |
Protein Description | Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form.. | |
Protein Sequence | MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PLF4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PLF4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PLF4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRBM_HUMAN | THBD | physical | 9395524 | |
PROC_HUMAN | PROC | physical | 9395524 | |
PLF4_HUMAN | PF4 | physical | 8031770 | |
LDLR_HUMAN | LDLR | physical | 11986215 | |
PLF4_HUMAN | PF4 | physical | 7547867 | |
SDF1_HUMAN | CXCL12 | physical | 10233851 | |
PLF4_HUMAN | PF4 | physical | 7835432 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...