UniProt ID | PKRI1_HUMAN | |
---|---|---|
UniProt AC | Q9H875 | |
Protein Name | PRKR-interacting protein 1 | |
Gene Name | PRKRIP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 184 | |
Subcellular Localization | Nucleus, nucleolus. | |
Protein Description | Binds double-stranded RNA. Inhibits EIF2AK2 kinase activity (By similarity).. | |
Protein Sequence | MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLDAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MASPAASSVR -----CCCCCCCCCC | 17.48 | 25159151 | |
7 | Phosphorylation | -MASPAASSVRPPRP -CCCCCCCCCCCCCC | 31.32 | 26074081 | |
8 | Phosphorylation | MASPAASSVRPPRPK CCCCCCCCCCCCCCC | 19.88 | 26074081 | |
10 | Methylation | SPAASSVRPPRPKKE CCCCCCCCCCCCCCC | 37.14 | 115388773 | |
13 | Methylation | ASSVRPPRPKKEPQT CCCCCCCCCCCCCCE | 59.35 | 115488797 | |
15 | Methylation | SVRPPRPKKEPQTLV CCCCCCCCCCCCEEE | 71.67 | 115488803 | |
51 | Acetylation | KAVPIPEKMSEWAPR CCCCCCHHHHHCCCC | 42.23 | 25953088 | |
70 | Phosphorylation | FVRDVMGSSAGAGSG HHHHHHCCCCCCCCC | 10.02 | 29396449 | |
71 | Phosphorylation | VRDVMGSSAGAGSGE HHHHHCCCCCCCCCC | 25.62 | 29396449 | |
76 | Phosphorylation | GSSAGAGSGEFHVYR CCCCCCCCCCHHHHH | 34.32 | 25159151 | |
82 | Phosphorylation | GSGEFHVYRHLRRRE CCCCHHHHHHHHHHH | 5.46 | 21712546 | |
90 | Phosphorylation | RHLRRREYQRQDYMD HHHHHHHHHHHHHHH | 13.74 | - | |
126 | Acetylation | AAEEQTAKRRKKRQK HHHHHHHHHHHHHHH | 57.00 | 25953088 | |
162 | Phosphorylation | GQPKEQGSSSSAEAS CCCCCCCCCCCCCCC | 27.09 | 25849741 | |
163 | Phosphorylation | QPKEQGSSSSAEASG CCCCCCCCCCCCCCC | 34.83 | 25849741 | |
164 | Phosphorylation | PKEQGSSSSAEASGT CCCCCCCCCCCCCCC | 34.95 | 25849741 | |
165 | Phosphorylation | KEQGSSSSAEASGTE CCCCCCCCCCCCCCC | 31.88 | 25849741 | |
169 | Phosphorylation | SSSSAEASGTEEEEE CCCCCCCCCCCCCCC | 37.44 | 25849741 | |
171 | Phosphorylation | SSAEASGTEEEEEVP CCCCCCCCCCCCCCC | 37.41 | 25849741 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PKRI1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PKRI1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PKRI1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
E2AK2_HUMAN | EIF2AK2 | physical | 12679338 | |
A4_HUMAN | APP | physical | 21832049 | |
CEP70_HUMAN | CEP70 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-162; SER-163; SER-164;SER-165; SER-169 AND THR-171, AND MASS SPECTROMETRY. |