UniProt ID | PHOP2_HUMAN | |
---|---|---|
UniProt AC | Q8TCD6 | |
Protein Name | Pyridoxal phosphate phosphatase PHOSPHO2 | |
Gene Name | PHOSPHO2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 241 | |
Subcellular Localization | ||
Protein Description | Phosphatase that has high activity toward pyridoxal 5'-phosphate (PLP). Also active at much lower level toward pyrophosphate, phosphoethanolamine (PEA), phosphocholine (PCho), phospho-l-tyrosine, fructose-6-phosphate, p-nitrophenyl phosphate, and h-glycerophosphate.. | |
Protein Sequence | MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLGDKGVREHEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCIIISDSNSVFIDWVLEAASFHDIFDKVFTNPAAFNSNGHLTVENYHTHSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVYIGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWSSGVDIISHLQFLIKD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
70 | Phosphorylation | HEMKRAVTSLPFTPG HHHHHHHHCCCCCHH | 24.46 | 27282143 | |
71 | Phosphorylation | EMKRAVTSLPFTPGM HHHHHHHCCCCCHHH | 27.69 | 27282143 | |
75 | Phosphorylation | AVTSLPFTPGMVELF HHHCCCCCHHHHHHH | 19.59 | 27282143 | |
171 | Phosphorylation | QLQQGVNYTQIVYIG HHHCCCCEEEEEEEC | 9.52 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PHOP2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PHOP2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PHOP2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TDIF1_HUMAN | DNTTIP1 | physical | 28514442 | |
SIGL5_HUMAN | SIGLEC5 | physical | 28514442 | |
CPNE4_HUMAN | CPNE4 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...