PHLP_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PHLP_RAT
• UniProt AC: Q63737
• Protein Name: Phosducin-like protein
• Gene Name: Pdcl
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 301
• Subcellular Localization: Cell projection, cilium .
• Protein Description: Functions as a co-chaperone for CCT in the assembly of heterotrimeric G protein complexes, facilitates the assembly of both Gbeta-Ggamma and RGS-Gbeta5 heterodimers. Acts also as a positive regulator of hedgehog signaling and regulates ciliary function..
• Protein Sequence: MTTLDDKLLGEKLQYYYSTSEDEDSDHEDKDRGRGAPASSSTPAEAELAGEGISVNTGPKGVINDWRRFKQLETEQREEQCREMERLIKKLSMSCRSHLDEEEEQQKQKDLQEKISGKMTLKECGMMDKNLDDEEFLQQYRKQRMDEMRQQLHKGPQFKQVLEIPSGEGFLDMIDKEQKSTLIMVHIYEDGVPGTEAMNGCMICLAAEYPTVKFCRVRSSVIGASSRFTRNALPALLIYKAGELIGNFVRVTDQLGEDFFAVDLEAFLQEFGLLPEKEVLVLTSVRNSATCHSEDSDLEID

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MTTLDDKLL ------CCCHHHHHH	35.75	-
16	Phosphorylation	LGEKLQYYYSTSEDE HHHHHHHEECCCCCC	4.30	22673903
17	Phosphorylation	GEKLQYYYSTSEDED HHHHHHEECCCCCCC	10.67	22673903
18	Phosphorylation	EKLQYYYSTSEDEDS HHHHHEECCCCCCCC	14.88	22817900
19	Phosphorylation	KLQYYYSTSEDEDSD HHHHEECCCCCCCCC	21.73	22817900
20	Phosphorylation	LQYYYSTSEDEDSDH HHHEECCCCCCCCCC	36.79	22817900
25	Phosphorylation	STSEDEDSDHEDKDR CCCCCCCCCCCCCCC	38.53	22673903
39	Phosphorylation	RGRGAPASSSTPAEA CCCCCCCCCCCHHHH	24.62	30181290
40	Phosphorylation	GRGAPASSSTPAEAE CCCCCCCCCCHHHHH	40.10	30181290
41	Phosphorylation	RGAPASSSTPAEAEL CCCCCCCCCHHHHHH	35.60	30181290
42	Phosphorylation	GAPASSSTPAEAELA CCCCCCCCHHHHHHC	28.59	30181290
142	Ubiquitination	EFLQQYRKQRMDEMR HHHHHHHHHHHHHHH	37.00	-
226	Phosphorylation	SSVIGASSRFTRNAL CCCCCCCCCCCCCHH	30.77	-
288	Phosphorylation	VLTSVRNSATCHSED EEEEECCCCCCCCCC	17.87	27097102
290	Phosphorylation	TSVRNSATCHSEDSD EEECCCCCCCCCCCC	15.57	27097102
293	Phosphorylation	RNSATCHSEDSDLEI CCCCCCCCCCCCCCC	45.29	27097102
296	Phosphorylation	ATCHSEDSDLEID-- CCCCCCCCCCCCC--	39.79	27097102

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
18	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
19	T	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
20	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PHLP_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PHLP_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRS8_MOUSE	Psmc5	physical	9551090

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.