| UniProt ID | PGFS_HUMAN | |
|---|---|---|
| UniProt AC | Q8TBF2 | |
| Protein Name | Prostamide/prostaglandin F synthase | |
| Gene Name | FAM213B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 198 | |
| Subcellular Localization | Cytoplasm, cytosol. | |
| Protein Description | Catalyzes the reduction of prostaglandin-ethanolamide H(2) (prostamide H(2)) to prostamide F(2alpha) with NADPH as proton donor. Also able to reduce prostaglandin H(2) to prostaglandin F(2alpha) (By similarity).. | |
| Protein Sequence | MSTVDLARVGACILKHAVTGEAVELRSLWREHACVVAGLRRFGCVVCRWIAQDLSSLAGLLDQHGVRLVGVGPEALGLQEFLDGDYFAGELYLDESKQLYKELGFKRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 (in isoform 5) | Phosphorylation | - | 36.82 | - | |
| 7 (in isoform 5) | Phosphorylation | - | 10.31 | - | |
| 9 (in isoform 5) | Phosphorylation | - | 4.79 | - | |
| 101 (in isoform 2) | Ubiquitination | - | 55.87 | 21890473 | |
| 101 | Ubiquitination | DESKQLYKELGFKRY HHHHHHHHHHCCCCC | 55.87 | 21890473 | |
| 101 | Ubiquitination | DESKQLYKELGFKRY HHHHHHHHHHCCCCC | 55.87 | 21890473 | |
| 101 | Ubiquitination | DESKQLYKELGFKRY HHHHHHHHHHCCCCC | 55.87 | 21890473 | |
| 101 (in isoform 1) | Ubiquitination | - | 55.87 | 21890473 | |
| 120 | Ubiquitination | ILPAALGKPVRDVAA CHHHHHCCCHHHHHH | 40.98 | 21890473 | |
| 120 (in isoform 1) | Ubiquitination | - | 40.98 | 21890473 | |
| 120 | Acetylation | ILPAALGKPVRDVAA CHHHHHCCCHHHHHH | 40.98 | 25953088 | |
| 131 | Ubiquitination | DVAAKAKAVGIQGNL HHHHHHHHHCCCCCC | 15.04 | 21890473 | |
| 131 | Ubiquitination | DVAAKAKAVGIQGNL HHHHHHHHHCCCCCC | 15.04 | 21890473 | |
| 131 | Ubiquitination | DVAAKAKAVGIQGNL HHHHHHHHHCCCCCC | 15.04 | 21890473 | |
| 138 | Ubiquitination | AVGIQGNLSGDLLQS HHCCCCCCCCCCCCC | 8.50 | 21890473 | |
| 138 | Ubiquitination | AVGIQGNLSGDLLQS HHCCCCCCCCCCCCC | 8.50 | 21890473 | |
| 148 (in isoform 3) | Ubiquitination | - | 3.61 | 21906983 | |
| 150 | Ubiquitination | LQSGGLLVVSKGGDK CCCCCEEEEEECCCE | 5.70 | 21890473 | |
| 150 | Ubiquitination | LQSGGLLVVSKGGDK CCCCCEEEEEECCCE | 5.70 | 21890473 | |
| 150 | Ubiquitination | LQSGGLLVVSKGGDK CCCCCEEEEEECCCE | 5.70 | 21890473 | |
| 182 (in isoform 2) | Phosphorylation | - | 2.85 | 28152594 | |
| 200 (in isoform 7) | Phosphorylation | - | 28152594 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PGFS_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PGFS_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PGFS_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NUCB1_HUMAN | NUCB1 | physical | 26186194 | |
| RASH_HUMAN | HRAS | physical | 26186194 | |
| SYNC_HUMAN | NARS | physical | 26186194 | |
| EPCR_HUMAN | PROCR | physical | 26186194 | |
| NUCB1_HUMAN | NUCB1 | physical | 28514442 | |
| SYNC_HUMAN | NARS | physical | 28514442 | |
| BCAT1_HUMAN | BCAT1 | physical | 28514442 | |
| RASH_HUMAN | HRAS | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
