| UniProt ID | PG12A_HUMAN | |
|---|---|---|
| UniProt AC | Q9BZM1 | |
| Protein Name | Group XIIA secretory phospholipase A2 | |
| Gene Name | PLA2G12A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 189 | |
| Subcellular Localization | Secreted . Cytoplasm . | |
| Protein Description | PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine.. | |
| Protein Sequence | MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 130 | Phosphorylation | DCDEEFQYCLSKICR CCHHHHHHHHHHHHH | 10.73 | - | |
| 142 | Phosphorylation | ICRDVQKTLGLTQHV HHHHHHHHHCCHHHH | 14.68 | 29978859 | |
| 146 | Phosphorylation | VQKTLGLTQHVQACE HHHHHCCHHHHHHHH | 18.16 | 29978859 | |
| 154 | Phosphorylation | QHVQACETTVELLFD HHHHHHHHHHHHHHH | 35.71 | 29978859 | |
| 155 | Phosphorylation | HVQACETTVELLFDS HHHHHHHHHHHHHHH | 6.95 | 29978859 | |
| 162 | Phosphorylation | TVELLFDSVIHLGCK HHHHHHHHHHHCCCC | 18.68 | 29978859 | |
| 171 | Phosphorylation | IHLGCKPYLDSQRAA HHCCCCHHHHHHCHH | 14.50 | 29978859 | |
| 174 | Phosphorylation | GCKPYLDSQRAACRC CCCHHHHHHCHHHHC | 20.97 | 29978859 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PG12A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PG12A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PG12A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RS6_HUMAN | RPS6 | physical | 21988832 | |
| UCK1_HUMAN | UCK1 | physical | 21988832 | |
| RB_HUMAN | RB1 | physical | 21988832 | |
| UMPS_HUMAN | UMPS | physical | 21988832 | |
| RS15_HUMAN | RPS15 | physical | 21988832 | |
| 1433G_HUMAN | YWHAG | physical | 21988832 | |
| CCGL_HUMAN | TMEM37 | physical | 21988832 | |
| PXDN_HUMAN | PXDN | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
