PEX26_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PEX26_HUMAN
• UniProt AC: Q7Z412
• Protein Name: Peroxisome assembly protein 26
• Gene Name: PEX26
• Organism: Homo sapiens (Human).
• Sequence Length: 305
• Subcellular Localization: Peroxisome membrane ; Single-pass type II membrane protein .
• Protein Description: Probably required for protein import into peroxisomes. Anchors PEX1 and PEX6 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into peroxisomes. Involved in the import of catalase and proteins containing a PTS2 target sequence, but not in import of proteins with a PTS1 target sequence..
• Protein Sequence: MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLDFRAALETCERAWQSLANHAVAEEPAGTSLEVKCSLCVVGIQALAEMDRWQEVLSWVLQYYQVPEKLPPKVLELCILLYSKMQEPGAVLDVVGAWLQDPANQNLPEYGALAEFHVQRVLLPLGCLSEAEELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHKFLSLPMLVRQLWDSAVSHFFSLPFKKSLLAALILCLLVVRFDPASPSSLHFLYKLAQLFRWIRKAAFSRLYQLRIRD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MKSDSSTSAA -----CCCCCCCCCC	41.23	-
5	Phosphorylation	---MKSDSSTSAAPL ---CCCCCCCCCCCC	42.48	24719451
7	Phosphorylation	-MKSDSSTSAAPLRG -CCCCCCCCCCCCCC	26.74	21815630
8	Phosphorylation	MKSDSSTSAAPLRGL CCCCCCCCCCCCCCC	25.12	24719451
211	Phosphorylation	QQQKQEHSGSEEAQK HHHHHHCCCCHHHCC	43.17	26471730
213	Phosphorylation	QKQEHSGSEEAQKPN HHHHCCCCHHHCCCC	34.97	25056879
224	Phosphorylation	QKPNLEGSVSHKFLS CCCCCCCHHHHHHHC	15.86	25159151

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PEX26_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PEX26_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PEX26_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PEX1_HUMAN	PEX1	physical	12717447
PEX6_HUMAN	PEX6	physical	12717447

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.