dbPTM

PEP12_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PEP12_SCHPO
UniProt AC	O94651
Protein Name	Syntaxin pep12
Gene Name	pep12
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	263
Subcellular Localization	Endoplasmic reticulum .
Protein Description	Has a role in vesicle-mediated transport but not with protein transport from Golgi to vesicle..
Protein Sequence	MSFVDLEQGRHKIEQNGDFPALASSIAQEIHALRGNTAAIHRYLVNNLTKNLHEVLEQSRELSQKVRSDLVRLANIKDTKYGEEASSFALSKLTRDFNTVLAELQRVQQKCAQQESDSVAAAQAALNQDVGQHFIEEEERNVSLSNNSSGQRQPLTESKISNSQLEYQQRLINERQGEIENLTQGINELNEIFRDLSTIINEQGELVTNIEYNVGNTSTNTKNASRQLQIANEHSRKARKRSFCFLVILVVILGVILTALIMG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSFVDLEQG ------CCCCCHHHC	33.70	24763107
148	Phosphorylation	NVSLSNNSSGQRQPL CCCCCCCCCCCCCCC	39.84	28889911
161	Phosphorylation	PLTESKISNSQLEYQ CCCHHHCCHHHHHHH	33.88	29996109
163	Phosphorylation	TESKISNSQLEYQQR CHHHCCHHHHHHHHH	29.38	28889911
225	Phosphorylation	STNTKNASRQLQIAN CCCCCHHHHHHHHHH	29.92	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PEP12_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PEP12_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PEP12_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
IINMP_SCHPO	ima1	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PEP12_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-148 AND SER-163, ANDMASS SPECTROMETRY.	18257517 [Abstract]