PELI2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PELI2_MOUSE
• UniProt AC: Q8BST6
• Protein Name: E3 ubiquitin-protein ligase pellino homolog 2
• Gene Name: Peli2
• Organism: Mus musculus (Mouse).
• Sequence Length: 419
• Protein Description: E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates IL1B-induced IRAK1 'Lys-63'-linked polyubiquitination and possibly 'Lys-48'-linked ubiquitination. May be important for LPS- and IL1B-induced MAP3K7-dependent, but not MAP3K3-dependent, NF-kappa-B activation. Can activate the MAP (mitogen activated protein) kinase pathway leading to activation of ELK1..
• Protein Sequence: MFSPGQEEPSAPNKEPVKYRELVVLGYNGALPNGDRGRRKSRFALYKRTYASGVKPSTIHMVSTPQASKAISSRGHHSISYTLSRSQTVVVEYTHDKDTDMFQVGRSTESPIDFVVTDTVSGGQNEDAQITQSTISRFACRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPQGGFTEESQPGVWREISVCGDVYTLRETRSAQQRGKLVESETNVLQDGSLIDLCGATLLWRTADGLFHAPTQKHIEALRQEINAARPQCPVGLNTLAFPSINRKEVVEEKQPWAYLSCGHVHGYHSWGHRSDTEANERECPMCRTVGPYVPLWLGCEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHAFHAACPFCATQLVGEQNCIKLIFQGPVD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
73	Phosphorylation	QASKAISSRGHHSIS HHHHHHHHCCCCEEE	35.85	25338131
78	Phosphorylation	ISSRGHHSISYTLSR HHHCCCCEEEEEECC	13.93	29550500
80	Phosphorylation	SRGHHSISYTLSRSQ HCCCCEEEEEECCCC	18.32	29550500
81	Phosphorylation	RGHHSISYTLSRSQT CCCCEEEEEECCCCE	15.27	29514104
82	Phosphorylation	GHHSISYTLSRSQTV CCCEEEEEECCCCEE	16.09	29550500
84	Phosphorylation	HSISYTLSRSQTVVV CEEEEEECCCCEEEE	23.30	29550500
86	Phosphorylation	ISYTLSRSQTVVVEY EEEEECCCCEEEEEE	27.16	25338131
150	Phosphorylation	VCDRNEPYTARIFAA ECCCCCCEEEEEEEE	13.57	-
289	Phosphorylation	QCPVGLNTLAFPSIN CCCCCCCCEECCCCC	25.22	25619855
294	Phosphorylation	LNTLAFPSINRKEVV CCCEECCCCCHHHHH	26.49	25619855

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PELI2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PELI2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PELI2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BCL10_MOUSE	Bcl10	physical	15213237

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.