PDX12_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PDX12_ARATH
• UniProt AC: Q9ZNR6
• Protein Name: Pyridoxal 5'-phosphate synthase-like subunit PDX1.2
• Gene Name: PDX12
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 314
• Subcellular Localization: Cytoplasm .
• Protein Description: The protein has no function in the formation of pyridoxal 5'-phosphate..
• Protein Sequence: MADQAMTDQDQGAVTLYSGTAITDAKKNHPFSVKVGLAQVLRGGAIVEVSSVNQAKLAESAGACSVIVSDPVRSRGGVRRMPDPVLIKEVKRAVSVPVMARARVGHFVEAQILESLAVDYIDESEIISVADDDHFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGDLTATGNIAETVKNVRSLMGEVRVLNNMDDDEVFTFAKKISAPYDLVAQTKQMGRVPVVQFASGGITTPADAALMMQLGCDGVFVGSEVFDGPDPFKKLRSIVQAVQHYNDPHVLAEMSSGLENAMESLNVRGDRIQDFGQGSV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MADQAMTDQ ------CCCCCCCCC	20.02	22223895
198	Sulfoxidation	EVRVLNNMDDDEVFT EEEEHHCCCCHHHHH	6.10	23289948

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PDX12_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PDX12_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PDX12_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PDX12_ARATH	PDX1.2	physical	16766694

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.