PDF_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PDF_DROME
• UniProt AC: O96690
• Protein Name: Protein PDF
• Gene Name: Pdf
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 102
• Subcellular Localization: Secreted.
• Protein Description: Neuropeptide PDF is the main transmitter regulating circadian locomotor rhythms. Required to maintain behavioral rhythms under constant conditions by coordinating pacemaker interactions in the circadian system. Ectopic expression induces long periods, while its absence leads to short periods..
• Protein Sequence: MARYTYLVALVLLAICCQWGYCGAMAMPDEERYVRKEYNRDLLDWFNNVGVGQFSPGQVATLCRYPLILENSLGPSVPIRKRNSELINSLLSLPKNMNDAGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
100	Alanine amide	LPKNMNDAGK----- CCCCCCCCCC-----	23.75	-
100	Amidation	LPKNMNDAGK----- CCCCCCCCCC-----	23.75	21214272

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PDF_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PDF_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PDF_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PDFR_DROME	Pdfr	genetic	16242402
DIUX_DROME	Dh31	genetic	25455031

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.