dbPTM

PCFS5_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PCFS5_ARATH
UniProt AC	Q9FIX8
Protein Name	Polyadenylation and cleavage factor homolog 5 {ECO:0000305}
Gene Name	PCFS5 {ECO:0000303\|PubMed:18479511}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	410
Subcellular Localization	Nucleus .
Protein Description
Protein Sequence	MASNGSFSAQRNANAGTTMKRRNDNRGYGGGIGCYQEERNRYAPPQKRFRSQLQQQFRSGHNPLYHYGSNTNNNVSRVSSQSYNNYGVDVIASNSSFALPNNDSNTNNYQKPFVVYGNPNPQIVPLPLPYRKLDPLDSLPQWVPNSTPNYPVRSSNFVPNTPDFTNVQNPMNHSNMVSVVSQSMHQPIVLSKELTDLLSLLNNEKEKKTSEASNNDSLPVGLSFDNPSSLNVRHESVIKSLYSDMPRQCTSCGVRFKCQEEHSKHMDWHVRKNRSVKTTTRLGQQPKKSRGWLASASLWLCAPTGGGTVEVASFGGGEMQKKNEKDQVQKQHMVPADEDQKNCALCVEPFEEFFSHEADDWMYKDAVYLTKNGRIVHVKCMPEPRPAKDLREPSRVMSVTVPSVAKAILC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of PCFS5_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PCFS5_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PCFS5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PCFS5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CTF77_ARATH	CSTF77	physical	18479511
PCFS4_ARATH	PCFS4	physical	18479511

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PCFS5_ARATH

Related Literatures of Post-Translational Modification