UniProt ID | PAX5_MOUSE | |
---|---|---|
UniProt AC | Q02650 | |
Protein Name | Paired box protein Pax-5 | |
Gene Name | Pax5 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 391 | |
Subcellular Localization | Nucleus. | |
Protein Description | May play an important role in B-cell differentiation as well as neural development and spermatogenesis. Involved in the regulation of the CD19 gene, a B-lymphoid-specific target gene.. | |
Protein Sequence | MDLEKNYPTPRTIRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLTSPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSPAARGAAPPAAATAYDRH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
72 | Phosphorylation | VSKILGRYYETGSIK HHHHHCCHHCCCCCC | 12.12 | - | |
225 | Methylation | DFLRKQMRGDLFTQQ HHHHHHHCCCCCHHH | 32.74 | 16188107 | |
243 | Methylation | VLDRVFERQHYSDIF HHHHHHHHHHHCCCE | 19.67 | 16188115 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAX5_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAX5_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAX5_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DAXX_HUMAN | DAXX | physical | 11799127 | |
IMA1_HUMAN | KPNA2 | physical | 10748034 | |
LEF1_MOUSE | Lef1 | physical | 12244173 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...