PAWR_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PAWR_MOUSE
• UniProt AC: Q925B0
• Protein Name: PRKC apoptosis WT1 regulator protein
• Gene Name: Pawr
• Organism: Mus musculus (Mouse).
• Sequence Length: 333
• Subcellular Localization: Cytoplasm. Nucleus. Mainly cytoplasmic in absence of apoptosis signal and in normal cells. Nuclear in most cancer cell lines. Nuclear entry seems to be essential but not sufficient for apoptosis. Nuclear localization includes nucleoplasm and PML nucl
• Protein Description: Pro-apoptopic protein capable of selectively inducing apoptosis in cancer cells, sensitizing the cells to diverse apoptotic stimuli and causing regression of tumors in animal models. Induces apoptosis in certain cancer cells by activation of the Fas prodeath pathway and coparallel inhibition of NF-kappa-B transcriptional activity. Inhibits the transcriptional activation and augments the transcriptional repression mediated by WT1. Down-regulates the anti-apoptotic protein BCL2 via its interaction with WT1. Seems also to be a transcriptional repressor by itself. May be directly involved in regulating the amyloid precursor protein (APP) cleavage activity of BACE1 (By similarity)..
• Protein Sequence: MATGGYRSGGSTTTDFLEEWKAKREKMRAKQNPAGPGSSGGDPAAKSPAGSLTPTAVAGTSELNHGPAGAAAPAAPAPGALNCAHGSSTLPRAAPGSRRAEDECPSAAAASGAPGSRGDEEEPDSAREKGRSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAATLPDPGTSYLPQDPSRTVPGRYKSTTSAPEDEISNRYPRTDRSGFSRHNRDANAPASFSSSSTLEKRIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDMEDENEQLKQENKTLLKVVGQLTR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MATGGYRSGGSTTTD CCCCCCCCCCCCHHH	38.74	21659605
11	Phosphorylation	GGYRSGGSTTTDFLE CCCCCCCCCHHHHHH	26.55	26239621
12	Phosphorylation	GYRSGGSTTTDFLEE CCCCCCCCHHHHHHH	36.67	22817900
13	Phosphorylation	YRSGGSTTTDFLEEW CCCCCCCHHHHHHHH	26.51	29472430
14	Phosphorylation	RSGGSTTTDFLEEWK CCCCCCHHHHHHHHH	25.50	26824392
38	Phosphorylation	QNPAGPGSSGGDPAA CCCCCCCCCCCCCCC	29.01	28973931
39	Phosphorylation	NPAGPGSSGGDPAAK CCCCCCCCCCCCCCC	53.35	28973931
47	Phosphorylation	GGDPAAKSPAGSLTP CCCCCCCCCCCCCCC	18.43	26824392
51	Phosphorylation	AAKSPAGSLTPTAVA CCCCCCCCCCCEEEE	31.04	26643407
53	Phosphorylation	KSPAGSLTPTAVAGT CCCCCCCCCEEEECC	21.94	26824392
55	Phosphorylation	PAGSLTPTAVAGTSE CCCCCCCEEEECCCC	28.64	26824392
60	Phosphorylation	TPTAVAGTSELNHGP CCEEEECCCCCCCCC	14.86	23984901
61	Phosphorylation	PTAVAGTSELNHGPA CEEEECCCCCCCCCC	38.89	23984901
87	Phosphorylation	ALNCAHGSSTLPRAA CCCCCCCCCCCCCCC	15.41	26643407
88	Phosphorylation	LNCAHGSSTLPRAAP CCCCCCCCCCCCCCC	38.26	26643407
89	Phosphorylation	NCAHGSSTLPRAAPG CCCCCCCCCCCCCCC	42.34	26643407
116	Phosphorylation	AASGAPGSRGDEEEP HHCCCCCCCCCCCCC	31.84	26824392
125	Phosphorylation	GDEEEPDSAREKGRS CCCCCCHHHHHHCCC	39.68	26824392
155	Phosphorylation	KLREKRRSTGVVNIP HHHHHHHHCCCCCCC	33.28	26824392
156	Phosphorylation	LREKRRSTGVVNIPA HHHHHHHCCCCCCCH	31.98	27087446
223	Phosphorylation	PGRYKSTTSAPEDEI CCCCCCCCCCCHHHH	29.95	25338131
224	Phosphorylation	GRYKSTTSAPEDEIS CCCCCCCCCCHHHHH	41.75	28973931
254	Phosphorylation	RDANAPASFSSSSTL CCCCCCCCCCCCHHH	25.30	22817900
256	Phosphorylation	ANAPASFSSSSTLEK CCCCCCCCCCHHHHH	27.15	18846507
257	Phosphorylation	NAPASFSSSSTLEKR CCCCCCCCCHHHHHH	26.71	18846507
258	Phosphorylation	APASFSSSSTLEKRI CCCCCCCCHHHHHHH	26.58	18846507
259	Phosphorylation	PASFSSSSTLEKRIE CCCCCCCHHHHHHHH	38.67	18846507
260	Phosphorylation	ASFSSSSTLEKRIED CCCCCCHHHHHHHHH	40.67	18846507
326	Acetylation	QENKTLLKVVGQLTR HHHHHHHHHHHHHCC	37.68	21728379
326	Ubiquitination	QENKTLLKVVGQLTR HHHHHHHHHHHHHCC	37.68	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
156	T	Phosphorylation	Kinase	PKA	-	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
156	T	Phosphorylation	Preferentially phosphorylated at the Thr-156 by PKC in cancer cells.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PAWR_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DRD2_MOUSE	Drd2	physical	16051151

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.