UniProt ID | PAK3_MOUSE | |
---|---|---|
UniProt AC | Q61036 | |
Protein Name | Serine/threonine-protein kinase PAK 3 | |
Gene Name | Pak3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 559 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, or cell cycle regulation. Plays a role in dendrite spine morphogenesis as well as synapse formation and plasticity. [PubMed: 25851601 Acts as downstream effector of the small GTPases CDC42 and RAC1. Activation by the binding of active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Phosphorylates MAPK4 and MAPK6 and activates the downstream target MAPKAPK5, a regulator of F-actin polymerization and cell migration. Additionally, phosphorylates TNNI3/troponin I to modulate calcium sensitivity and relaxation kinetics of thin myofilaments. May also be involved in early neuronal development.] | |
Protein Sequence | MSDSLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHQSNTKTASEPPLAPPVSEEEDEEEEEEEDDNEPPPVIAPRPEHTKSIYTRSVVESIASPAAPNKEDIPPSAENANSTTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSDSLDNEE ------CCCCCCCCC | 35.59 | 26824392 | |
4 | Phosphorylation | ----MSDSLDNEEKP ----CCCCCCCCCCC | 30.25 | 26643407 | |
20 | Phosphorylation | APPLRMNSNNRDSSA CCCCCCCCCCCCCCC | 26.58 | 29514104 | |
25 | Phosphorylation | MNSNNRDSSALNHSS CCCCCCCCCCCCCCC | 17.80 | 29550500 | |
26 | Phosphorylation | NSNNRDSSALNHSSK CCCCCCCCCCCCCCC | 40.85 | 29550500 | |
45 | Acetylation | APEEKNKKARLRSIF CCHHHCHHHHHHHHC | 48.40 | 7619027 | |
50 | Phosphorylation | NKKARLRSIFPGGGD CHHHHHHHHCCCCCC | 32.92 | 29899451 | |
120 | Phosphorylation | WARLLQTSNITKLEQ HHHHHHHCCCHHHHH | 17.18 | 29514104 | |
124 | Acetylation | LQTSNITKLEQKKNP HHHCCCHHHHHCCCH | 46.35 | 22826441 | |
139 | Ubiquitination | QAVLDVLKFYDSKET HHHHHHHHHHCCCCC | 41.55 | - | |
143 | Phosphorylation | DVLKFYDSKETVNNQ HHHHHHCCCCCCCCE | 22.47 | 25338131 | |
146 | Phosphorylation | KFYDSKETVNNQKYM HHHCCCCCCCCEEEE | 32.07 | 29899451 | |
154 | Phosphorylation | VNNQKYMSFTSGDKS CCCEEEEEEECCCCC | 23.45 | 26824392 | |
156 | Phosphorylation | NQKYMSFTSGDKSAH CEEEEEEECCCCCCC | 25.21 | 29550500 | |
157 | Phosphorylation | QKYMSFTSGDKSAHG EEEEEEECCCCCCCE | 42.88 | 29899451 | |
161 | Phosphorylation | SFTSGDKSAHGYIAA EEECCCCCCCEEEEE | 30.18 | 23684622 | |
165 | Phosphorylation | GDKSAHGYIAAHQSN CCCCCCEEEEEECCC | 4.22 | 29514104 | |
171 | Phosphorylation | GYIAAHQSNTKTASE EEEEEECCCCCCCCC | 36.28 | 23684622 | |
175 | Phosphorylation | AHQSNTKTASEPPLA EECCCCCCCCCCCCC | 33.12 | 25619855 | |
177 | Phosphorylation | QSNTKTASEPPLAPP CCCCCCCCCCCCCCC | 56.73 | 25619855 | |
186 | Phosphorylation | PPLAPPVSEEEDEEE CCCCCCCCHHHCHHH | 45.09 | 25521595 | |
213 | Phosphorylation | IAPRPEHTKSIYTRS CCCCHHCCCCCHHHH | 25.48 | 25619855 | |
215 | Phosphorylation | PRPEHTKSIYTRSVV CCHHCCCCCHHHHHH | 23.22 | 29550500 | |
217 | Phosphorylation | PEHTKSIYTRSVVES HHCCCCCHHHHHHHH | 11.82 | 29550500 | |
218 | Phosphorylation | EHTKSIYTRSVVESI HCCCCCHHHHHHHHH | 18.13 | 29550500 | |
220 | Phosphorylation | TKSIYTRSVVESIAS CCCCHHHHHHHHHCC | 23.79 | 27180971 | |
224 | Phosphorylation | YTRSVVESIASPAAP HHHHHHHHHCCCCCC | 16.31 | 26643407 | |
227 | Phosphorylation | SVVESIASPAAPNKE HHHHHHCCCCCCCCC | 17.25 | 26643407 | |
239 | Phosphorylation | NKEDIPPSAENANST CCCCCCCCCCCCCCC | 42.75 | 25777480 | |
245 | Phosphorylation | PSAENANSTTLYRNT CCCCCCCCCCEECCC | 21.99 | 25777480 | |
246 | Phosphorylation | SAENANSTTLYRNTD CCCCCCCCCEECCCH | 22.19 | 25777480 | |
247 | Phosphorylation | AENANSTTLYRNTDR CCCCCCCCEECCCHH | 22.93 | 25777480 | |
249 | Phosphorylation | NANSTTLYRNTDRQR CCCCCCEECCCHHHH | 10.34 | 25777480 | |
259 | Phosphorylation | TDRQRKKSKMTDEEI CHHHHHHHCCCHHHH | 30.60 | 29899451 | |
272 | Phosphorylation | EILEKLRSIVSVGDP HHHHHHHHHHCCCCC | 37.47 | 25521595 | |
275 | Phosphorylation | EKLRSIVSVGDPKKK HHHHHHHCCCCCCCC | 20.79 | - | |
404 | Ubiquitination | QVIHRDIKSDNILLG CCEECCCCCCCEEEC | 56.92 | - | |
435 | Phosphorylation | TPEQSKRSTMVGTPY CHHHHCCCCCCCCCC | 25.29 | 25266776 | |
436 | Phosphorylation | PEQSKRSTMVGTPYW HHHHCCCCCCCCCCC | 21.65 | 25521595 | |
440 | Phosphorylation | KRSTMVGTPYWMAPE CCCCCCCCCCCCCCH | 11.20 | 22322096 | |
442 | Phosphorylation | STMVGTPYWMAPEVV CCCCCCCCCCCCHHH | 13.98 | 29550500 | |
538 | Succinylation | HPFLKLAKPLSSLTP CHHHHHHCCHHHCHH | 57.85 | 23806337 | |
538 | Acetylation | HPFLKLAKPLSSLTP CHHHHHHCCHHHCHH | 57.85 | 23806337 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAK3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAK3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAK3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RHOQ_HUMAN | RHOQ | physical | 10445846 | |
ARHG7_MOUSE | Arhgef7 | physical | 9726964 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...