UniProt ID | PAG15_HUMAN | |
---|---|---|
UniProt AC | Q8NCC3 | |
Protein Name | Group XV phospholipase A2 | |
Gene Name | PLA2G15 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 412 | |
Subcellular Localization |
Lysosome . Secreted . Membrane Peripheral membrane protein . |
|
Protein Description | Has transacylase and calcium-independent phospholipase A2 activity. [PubMed: 20410020] | |
Protein Sequence | MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
99 | N-linked_Glycosylation | DNIRLVYNKTSRATQ HCEEEEEECCCCCCC | 33.38 | 25727495 | |
100 | Ubiquitination | NIRLVYNKTSRATQF CEEEEEECCCCCCCC | 30.14 | - | |
120 | Ubiquitination | VRVPGFGKTFSLEFL EECCCCCCEEEEEEC | 44.10 | 22817900 | |
152 | Ubiquitination | LVGWGYTRGEDVRGA HHCCCCCCCCCCCCC | 37.71 | 22817900 | |
219 | Phosphorylation | PQAWKDKYIRAFVSL CHHHHHHHHHHHHHC | 13.03 | - | |
225 | Phosphorylation | KYIRAFVSLGAPWGG HHHHHHHHCCCCCCH | 18.03 | - | |
235 | Acetylation | APWGGVAKTLRVLAS CCCCHHHHHHHHHHC | 45.76 | 7826109 | |
273 | N-linked_Glycosylation | TSWLLPYNYTWSPEK CCEECCCCCCCCCCC | 26.31 | 25727495 | |
289 | N-linked_Glycosylation | FVQTPTINYTLRDYR EEECCCCCEEHHHHH | 26.64 | 25727495 | |
289 | N-linked_Glycosylation | FVQTPTINYTLRDYR EEECCCCCEEHHHHH | 26.64 | 16399764 | |
291 | Phosphorylation | QTPTINYTLRDYRKF ECCCCCEEHHHHHHH | 15.72 | 24719451 | |
398 | N-linked_Glycosylation | EHIEMLANATTLAYL HHHHHHHHHHHHHHH | 33.58 | 25727495 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAG15_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAG15_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAG15_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MIC60_HUMAN | IMMT | physical | 16169070 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...