dbPTM

PABN2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PABN2_ARATH
UniProt AC	Q9FJN9
Protein Name	Polyadenylate-binding protein 2 {ECO:0000303\|PubMed:18479511}
Gene Name	PABN2 {ECO:0000303\|PubMed:18479511}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	220
Subcellular Localization	Nucleus speckle . Cytoplasm . Shuttles between the nucleus and the cytoplasm but predominantly found in the nucleus.
Protein Description	Involved in the 3'-end formation of mRNA precursors (pre-mRNA) by the addition of a poly(A) tail of 200-250 nt to the upstream cleavage product. Stimulates poly(A) polymerase (PAPOLA) conferring processivity on the poly(A) tail elongation reaction and controls also the poly(A) tail length. Increases the affinity of poly(A) polymerase for RNA. Binds to poly(A) and to poly(G) with high affinity. May protect the poly(A) tail from degradation..
Protein Sequence	MEEEEHEVYGGEIPDVGEMDGDMEALNPDLDMAAADDDAVKELDEMKKRLKEMEDEAAALREMQAKVEKEMGAQDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTDKFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVLQKRTNVPGLKQFRGRRFNPYMGYRFRRPFMSPYMYSPYGYGKAPRFRRPMRYMPYQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of PABN2_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PABN2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PABN2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PABN2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
PABN2_ARATH	AT5G65260	physical	18479511

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PABN2_ARATH

Related Literatures of Post-Translational Modification