PA2GA_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PA2GA_MOUSE
• UniProt AC: P31482
• Protein Name: Phospholipase A2, membrane associated
• Gene Name: Pla2g2a
• Organism: Mus musculus (Mouse).
• Sequence Length: 146
• Subcellular Localization: Cell membrane ; Peripheral membrane protein . Secreted .
• Protein Description: Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. [PubMed: 8425615 Thought to participate in the regulation of phospholipid metabolism in biomembranes including eicosanoid biosynthesis. Independent of its catalytic activity, acts as a ligand for integrins. Binds to and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB. Binds to a site (site 2) which is distinct from the classical ligand-binding site (site 1) and induces integrin conformational changes and enhanced ligand binding to site 1. Induces cell proliferation in an integrin-dependent manner (By similarity]
• Protein Sequence: MKVLLLLAASIMAFGSIQVQGNIAQFGEMIRLKTGKRAELSYAFYGCHCGLGGKGSPKDATDRCCVTHDCCYKSLEKSGCGTKLLKYKYSHQGGQITCSANQNSCQKRLCQCDKAAAECFARNKKTYSLKYQFYPNMFCKGKKPKC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PA2GA_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PA2GA_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PA2GA_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PA2GA_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
P53_MOUSE	Trp53	genetic	10716720

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.