UniProt ID | PA216_HUMAN | |
---|---|---|
UniProt AC | P53816 | |
Protein Name | HRAS-like suppressor 3 {ECO:0000303|PubMed:17374643} | |
Gene Name | PLA2G16 {ECO:0000312|HGNC:HGNC:17825} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 162 | |
Subcellular Localization |
Membrane Single-pass membrane protein . Cytoplasm . Cytoplasm, perinuclear region . Peroxisome membrane . |
|
Protein Description | Lipid-modifying enzyme that acts as major regulator of adipocyte lipolysis by catalyzing the release of fatty acids from phospholipids in adipose tissue. [PubMed: 19615464] | |
Protein Sequence | MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PA216_HUMAN !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PA216_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PA216_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PA216_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBQL1_HUMAN | UBQLN1 | physical | 16189514 | |
2AAA_HUMAN | PPP2R1A | physical | 17374643 | |
UBQL1_HUMAN | UBQLN1 | physical | 25416956 | |
RASH_HUMAN | HRAS | physical | 24884338 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...