PA216_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PA216_HUMAN
• UniProt AC: P53816
• Protein Name: HRAS-like suppressor 3 {ECO:0000303|PubMed:17374643}
• Gene Name: PLA2G16 {ECO:0000312|HGNC:HGNC:17825}
• Organism: Homo sapiens (Human).
• Sequence Length: 162
• Subcellular Localization: Membrane ; Single-pass membrane protein . Cytoplasm . Cytoplasm, perinuclear region . Peroxisome membrane .
• Protein Description: Lipid-modifying enzyme that acts as major regulator of adipocyte lipolysis by catalyzing the release of fatty acids from phospholipids in adipose tissue. [PubMed: 19615464]
• Protein Sequence: MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PA216_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PA216_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PA216_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PA216_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBQL1_HUMAN	UBQLN1	physical	16189514
2AAA_HUMAN	PPP2R1A	physical	17374643
UBQL1_HUMAN	UBQLN1	physical	25416956
RASH_HUMAN	HRAS	physical	24884338

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.