UniProt ID | OXDD_HUMAN | |
---|---|---|
UniProt AC | Q99489 | |
Protein Name | D-aspartate oxidase | |
Gene Name | DDO | |
Organism | Homo sapiens (Human). | |
Sequence Length | 341 | |
Subcellular Localization | Peroxisome. | |
Protein Description | Selectively catalyzes the oxidative deamination of D-aspartate and its N-methylated derivative, N-methyl D-aspartate.. | |
Protein Sequence | MDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTEAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Phosphorylation | GAGVVGLSTAVCISK CCCHHHHHHHHHHHH | 14.37 | 24732914 | |
18 | Phosphorylation | AGVVGLSTAVCISKL CCHHHHHHHHHHHHH | 28.31 | 24732914 | |
23 | Phosphorylation | LSTAVCISKLVPRCS HHHHHHHHHHCCCCE | 18.14 | 24732914 | |
24 | Ubiquitination | STAVCISKLVPRCSV HHHHHHHHHCCCCEE | 33.32 | - | |
39 | Phosphorylation | TIISDKFTPDTTSDV EEECCCCCCCCCCCC | 26.45 | - | |
81 (in isoform 2) | Phosphorylation | - | 20.61 | 24719451 | |
81 | Phosphorylation | HLFAIANSAEAGDAG HHHHHHHHHCCCCCC | 20.61 | - | |
93 (in isoform 2) | Phosphorylation | - | 40.45 | 24719451 | |
109 | Phosphorylation | PTEEVPFWADVVLGF CCCCCCCHHHHHHCC | 5.86 | 24719451 | |
109 (in isoform 4) | Phosphorylation | - | 5.86 | 24719451 | |
118 (in isoform 1) | Ubiquitination | - | 48.16 | 21906983 | |
118 | Ubiquitination | DVVLGFRKMTEAELK HHHHCCCCCCHHHHH | 48.16 | 21906983 | |
121 | Phosphorylation | LGFRKMTEAELKKFP HCCCCCCHHHHHHCC | 36.33 | 24719451 | |
121 (in isoform 4) | Phosphorylation | - | 36.33 | 24719451 | |
125 (in isoform 1) | Ubiquitination | - | 43.82 | 21906983 | |
125 | Ubiquitination | KMTEAELKKFPQYVF CCCHHHHHHCCHHHH | 43.82 | 21906983 | |
146 | Ubiquitination | LKCECPAYLPWLEKR EEEECCCCHHHHHHH | 9.84 | - | |
153 | Ubiquitination | YLPWLEKRIKGSGGW CHHHHHHHCCCCCCC | 26.86 | - | |
225 | Phosphorylation | GSGLTYIYPGTSHVT CCCCEEECCCCCEEE | 5.79 | 24719451 | |
256 | Phosphorylation | ENSREILSRCCALEP HHHHHHHHHHHHCCH | 29.00 | 24719451 | |
334 | Phosphorylation | ECVHALRTPIPKSNL HHHHHHCCCCCCCCC | 26.81 | 27251275 | |
362 | Phosphorylation | ---------------------------- ---------------------------- | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OXDD_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OXDD_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OXDD_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PEX5_HUMAN | PEX5 | physical | 9820813 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...