UniProt ID | OVCA2_HUMAN | |
---|---|---|
UniProt AC | Q8WZ82 | |
Protein Name | Esterase OVCA2 | |
Gene Name | OVCA2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 227 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSDFGSCPPEEQPRGWWFSEQEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQFAE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | Phosphorylation | CLAGFRQSERGFREK HHHCCCHHHHHHHHH | 25.63 | 28857561 | |
149 | Phosphorylation | PRFILLVSGFCPRGI CCEEEEHHCCCCCCC | 26.56 | 21406692 | |
168 | Phosphorylation | SILQRPLSLPSLHVF HHHCCCCCCCCEEEE | 40.70 | 20068231 | |
171 | Phosphorylation | QRPLSLPSLHVFGDT CCCCCCCCEEEECCC | 36.08 | 28348404 | |
220 | Ubiquitination | PQRQAYLKFLDQFAE CHHHHHHHHHHHHCC | 31.07 | - | |
220 | Sumoylation | PQRQAYLKFLDQFAE CHHHHHHHHHHHHCC | 31.07 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OVCA2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OVCA2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OVCA2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MYH11_HUMAN | MYH11 | physical | 26186194 | |
PTN11_HUMAN | PTPN11 | physical | 26186194 | |
MYH11_HUMAN | MYH11 | physical | 28514442 | |
PTN11_HUMAN | PTPN11 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...