| UniProt ID | OVCA2_HUMAN | |
|---|---|---|
| UniProt AC | Q8WZ82 | |
| Protein Name | Esterase OVCA2 | |
| Gene Name | OVCA2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 227 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSDFGSCPPEEQPRGWWFSEQEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQFAE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 18 | Phosphorylation | CLAGFRQSERGFREK HHHCCCHHHHHHHHH | 25.63 | 28857561 | |
| 149 | Phosphorylation | PRFILLVSGFCPRGI CCEEEEHHCCCCCCC | 26.56 | 21406692 | |
| 168 | Phosphorylation | SILQRPLSLPSLHVF HHHCCCCCCCCEEEE | 40.70 | 20068231 | |
| 171 | Phosphorylation | QRPLSLPSLHVFGDT CCCCCCCCEEEECCC | 36.08 | 28348404 | |
| 220 | Ubiquitination | PQRQAYLKFLDQFAE CHHHHHHHHHHHHCC | 31.07 | - | |
| 220 | Sumoylation | PQRQAYLKFLDQFAE CHHHHHHHHHHHHCC | 31.07 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OVCA2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OVCA2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OVCA2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MYH11_HUMAN | MYH11 | physical | 26186194 | |
| PTN11_HUMAN | PTPN11 | physical | 26186194 | |
| MYH11_HUMAN | MYH11 | physical | 28514442 | |
| PTN11_HUMAN | PTPN11 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
