UniProt ID | OSTA_HUMAN | |
---|---|---|
UniProt AC | Q86UW1 | |
Protein Name | Organic solute transporter subunit alpha | |
Gene Name | SLC51A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 340 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. Endoplasmic reticulum membrane Multi-pass membrane protein. Transported from the endoplasmic reticulum to the plasma membrane upon interacting with SLC51B (By similarity). Mainly restricted to the lateral |
|
Protein Description | Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids.. | |
Protein Sequence | MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGPVELALTSILTLLALGSIAIFLEDAVYLYKNTLCPIKRRTLLWKSSAPTVVSVLCCFGLWIPRSLVLVEMTITSFYAVCFYLLMLVMVEGFGGKEAVLRTLRDTPMMVHTGPCCCCCPCCPRLLLTRKKLQLLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVSTLLALWTLGIISRQARLHLGEQNMGAKFALFQVLLILTALQPSIFSVLANGGQIACSPPYSSKTRSQVMNCHLLILETFLMTVLTRMYYRRKDHKVGYETFSSPDLDLNLKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | O-linked_Glycosylation | IKLDPRYTADLLEVL EECCCCCHHHHHHHH | 18.25 | 29237092 | |
38 | O-linked_Glycosylation | ACFSQPPTAAQLLRA HHHCCCCHHHHHHHH | 41.11 | 29237092 | |
193 | Phosphorylation | QYAFLKITLTLVGLF HHHHHHHHHHHHHHH | 16.47 | - | |
195 | Phosphorylation | AFLKITLTLVGLFLV HHHHHHHHHHHHHCC | 15.67 | - | |
240 | Phosphorylation | LWTLGIISRQARLHL HHHHHHHHHHHHHHC | 19.20 | - | |
330 | Phosphorylation | KVGYETFSSPDLDLN CCCCCCCCCCCCCCC | 48.67 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OSTA_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OSTA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OSTA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ANO6_HUMAN | ANO6 | physical | 28514442 | |
CSCL1_HUMAN | TMEM63A | physical | 28514442 | |
UBB_HUMAN | UBB | physical | 28514442 | |
FA8A1_HUMAN | FAM8A1 | physical | 28514442 | |
LNP_HUMAN | KIAA1715 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...