| UniProt ID | ORML3_HUMAN | |
|---|---|---|
| UniProt AC | Q8N138 | |
| Protein Name | ORM1-like protein 3 | |
| Gene Name | ORMDL3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 153 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling.. | |
| Protein Sequence | MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MNVGTAHSEVNP ---CCCCCCCCCCCC | 19.53 | - | |
| 63 (in isoform 4) | Ubiquitination | - | 1.95 | 21890473 | |
| 70 | Phosphorylation | FLHTVKGTPFETPDQ EEEEECCCCCCCCCC | 21.06 | 21406692 | |
| 74 | Phosphorylation | VKGTPFETPDQGKAR ECCCCCCCCCCCCEE | 32.32 | 21406692 | |
| 79 | Ubiquitination | FETPDQGKARLLTHW CCCCCCCCEEEEHHH | 25.38 | 21906983 | |
| 79 (in isoform 1) | Ubiquitination | - | 25.38 | 21890473 | |
| 136 (in isoform 4) | Ubiquitination | - | 2.37 | 21890473 | |
| 152 | Ubiquitination | VRIFGINKY------ EEEEEEECC------ | 50.87 | - | |
| 152 (in isoform 1) | Ubiquitination | - | 50.87 | 21890473 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ORML3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ORML3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ORML3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| EF1A1_HUMAN | EEF1A1 | physical | 16169070 | |
| SPTC1_HUMAN | SPTLC1 | physical | 20182505 | |
| A4_HUMAN | APP | physical | 21832049 | |
| SPY4_HUMAN | SPRY4 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 600807 | Asthma (ASTHMA) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
