OR4D6_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OR4D6_HUMAN
• UniProt AC: Q8NGJ1
• Protein Name: Olfactory receptor 4D6
• Gene Name: OR4D6
• Organism: Homo sapiens (Human).
• Sequence Length: 314
• Subcellular Localization: Cell membrane; Multi-pass membrane protein.
• Protein Description: Odorant receptor..
• Protein Sequence: MDQINHTNVKEFFFLELTRSRELEFFLFVVFFAVYVATVLGNALIVVTITCESRLHTPMYFLLRNKSVLDIVFSSITVPKFLVDLLSDRKTISYNDCMAQIFFFHFAGGADIFFLSVMAYDRYLAIAKPLHYVTMMRKEVWVALVVASWVSGGLHSIIQVILMLPFPFCGPNTLDAFYCYVLQVVKLACTDTFALELFMISNNGLVTLLWFLLLLGSYTVILVMLRSHSGEGRNKALSTCTSHMLVVTLHFVPCVYIYCRPFMTLPMDTTISINNTVITPMLNPIIYSLRNQEMKSAMQRLQRRLGPSESRKWG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	N-linked_Glycosylation	---MDQINHTNVKEF ---CCCCCCCCHHHE	30.23	UniProtKB CARBOHYD
77	Phosphorylation	DIVFSSITVPKFLVD HHHHHCCCCCHHHHH	32.48	24719451
288	Phosphorylation	MLNPIIYSLRNQEMK CCCHHHHHHCCHHHH	15.50	24719451
308	Phosphorylation	LQRRLGPSESRKWG- HHHHHCCCHHHCCC-	46.54	23663014
310	Phosphorylation	RRLGPSESRKWG--- HHHCCCHHHCCC---	43.42	23663014

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OR4D6_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OR4D6_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OR4D6_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.