UniProt ID | OR2W1_HUMAN | |
---|---|---|
UniProt AC | Q9Y3N9 | |
Protein Name | Olfactory receptor 2W1 | |
Gene Name | OR2W1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 320 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
Protein Description | Odorant receptor.. | |
Protein Sequence | MDQSNYSSLHGFILLGFSNHPKMEMILSGVVAIFYLITLVGNTAIILASLLDSQLHTPMYFFLRNLSFLDLCFTTSIIPQMLVNLWGPDKTISYVGCIIQLYVYMWLGSVECLLLAVMSYDRFTAICKPLHYFVVMNPHLCLKMIIMIWSISLANSVVLCTLTLNLPTCGNNILDHFLCELPALVKIACVDTTTVEMSVFALGIIIVLTPLILILISYGYIAKAVLRTKSKASQRKAMNTCGSHLTVVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVITPSLNPLIYTLRNKDMKDALKKLMRFHHKSTKIKRNCKS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | N-linked_Glycosylation | ---MDQSNYSSLHGF ---CCCCCHHHCCCC | 34.76 | UniProtKB CARBOHYD | |
161 | O-linked_Glycosylation | ANSVVLCTLTLNLPT HCHHHHHHHEECCCC | 20.72 | 29351928 | |
163 | O-linked_Glycosylation | SVVLCTLTLNLPTCG HHHHHHHEECCCCCC | 8.75 | 29351928 | |
228 | Phosphorylation | IAKAVLRTKSKASQR HHHHHHHCCCHHHHH | 35.19 | - | |
230 | Phosphorylation | KAVLRTKSKASQRKA HHHHHCCCHHHHHHH | 32.61 | - | |
233 | Phosphorylation | LRTKSKASQRKAMNT HHCCCHHHHHHHHHH | 33.96 | - | |
240 | Phosphorylation | SQRKAMNTCGSHLTV HHHHHHHHHCCHHHH | 12.73 | 28857561 | |
243 | Phosphorylation | KAMNTCGSHLTVVSM HHHHHHCCHHHHHHH | 19.92 | 28857561 | |
252 | Phosphorylation | LTVVSMFYGTIIYMY HHHHHHHHHHHEEEE | 12.52 | 28857561 | |
291 | Phosphorylation | SLNPLIYTLRNKDMK CCCHHHHHCCCCCHH | 16.55 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OR2W1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OR2W1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OR2W1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...