ODR4_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ODR4_DROME
• UniProt AC: Q9VTX8
• Protein Name: Protein odr-4 homolog
• Gene Name: CG10616
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 492
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Description: May play a role in the trafficking of a subset of G-protein coupled receptors..
• Protein Sequence: MRTVLLSKHDELYLEKCAQENQFSYGIIVGHQADLTKSVVVHLARNNEEDADLEDLSEVRLTISDINSQALASQWLSASKMCPGSFDVIGIFVSSVRSDVVNEQSAEFKNAKKLFSDIYDLLLKSNSSFGVYTTDIAQTDFVFLSYSLADKKVLCKNYSYGNGGTFTNMEFRFVDKPFEWIQLECSYDFDDVLPILDSSRRVNIEDQFQSMIVSVRKNLLASEVFLQNEVVEDTIDLQAYIKKKKTKVDKLQPTSTTGGTATASSNTTDSLPRLASEGIIGGTETIRASIVLPMKCQLSKPTDIKVREFSGTLHMSGIITSKVFCNPRNSIADVKRFLRDDVLRSLITRIQVYCDGLTDPYVTNEALYISEPPRRVFFSLPSEGPSASVGAVVQFSEYLFRGEAPTVVVAQAKQILDVDLDPETISVEAEGLPDDTHFNNCKMDADCIDDSGIMTSSMPKPELSRSLYMVGIAVALLVLLSSVALHFVLAER

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of ODR4_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ODR4_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ODR4_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ODR4_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UFSP2_DROME	CG16979	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.