| UniProt ID | ODAM_HUMAN | |
|---|---|---|
| UniProt AC | A1E959 | |
| Protein Name | Odontogenic ameloblast-associated protein | |
| Gene Name | ODAM | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 279 | |
| Subcellular Localization | Secreted . Cytoplasm . Nucleus . | |
| Protein Description | Tooth-associated epithelia protein that probably plays a role in odontogenesis, the complex process that results in the initiation and generation of the tooth. May be incorporated in the enamel matrix at the end of mineralization process. Involved in the induction of RHOA activity via interaction with ARHGEF and expression of downstream factors such as ROCK. Plays a role in attachment of the junctional epithelium to the tooth surface.. | |
| Protein Sequence | MKIIILLGFLGATLSAPLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 115 | O-linked_Glycosylation | VDPLQLQTPPQTQPG CCCCCCCCCCCCCCC | 45.59 | UniProtKB CARBOHYD | |
| 119 | O-linked_Glycosylation | QLQTPPQTQPGPSHV CCCCCCCCCCCCCCC | 42.37 | UniProtKB CARBOHYD | |
| 132 | Phosphorylation | HVMPYVFSFKMPQEQ CCCCEEEEEECCHHH | 17.57 | 24719451 | |
| 244 | O-linked_Glycosylation | AGVFMPSTSPKPSTT CCEECCCCCCCCCCC | 43.08 | UniProtKB CARBOHYD | |
| 249 | O-linked_Glycosylation | PSTSPKPSTTNVFTS CCCCCCCCCCCCCCC | 54.73 | UniProtKB CARBOHYD | |
| 250 | O-linked_Glycosylation | STSPKPSTTNVFTSA CCCCCCCCCCCCCCC | 30.80 | UniProtKB CARBOHYD | |
| 251 | O-linked_Glycosylation | TSPKPSTTNVFTSAV CCCCCCCCCCCCCCC | 33.45 | UniProtKB CARBOHYD | |
| 255 | O-linked_Glycosylation | PSTTNVFTSAVDQTI CCCCCCCCCCCCCCC | 16.11 | UniProtKB CARBOHYD | |
| 255 | Phosphorylation | PSTTNVFTSAVDQTI CCCCCCCCCCCCCCC | 16.11 | - | |
| 256 | O-linked_Glycosylation | STTNVFTSAVDQTIT CCCCCCCCCCCCCCC | 18.16 | UniProtKB CARBOHYD | |
| 256 | Phosphorylation | STTNVFTSAVDQTIT CCCCCCCCCCCCCCC | 18.16 | - | |
| 261 | O-linked_Glycosylation | FTSAVDQTITPELPE CCCCCCCCCCCCCCC | 23.50 | UniProtKB CARBOHYD | |
| 263 | O-linked_Glycosylation | SAVDQTITPELPEEK CCCCCCCCCCCCCCC | 17.69 | UniProtKB CARBOHYD | |
| 273 | O-linked_Glycosylation | LPEEKDKTDSLREP- CCCCCCCCCCCCCC- | 40.74 | UniProtKB CARBOHYD | |
| 275 | O-linked_Glycosylation | EEKDKTDSLREP--- CCCCCCCCCCCC--- | 34.26 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ODAM_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ODAM_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ODAM_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| FHL2_HUMAN | FHL2 | physical | 28514442 | |
| NISCH_HUMAN | NISCH | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
