OAS1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OAS1_HUMAN
• UniProt AC: P00973
• Protein Name: 2'-5'-oligoadenylate synthase 1
• Gene Name: OAS1
• Organism: Homo sapiens (Human).
• Sequence Length: 400
• Subcellular Localization: Cytoplasm . Mitochondrion . Nucleus . Microsome . Endoplasmic reticulum . Secreted. Associated with different subcellular fractions such as mitochondrial, nuclear, and rough/smooth microsomal fractions.
• Protein Description: Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L..
• Protein Sequence: MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Ubiquitination	DLRNTPAKSLDKFIE CCCCCCCHHHHHHHH	53.40	29967540
19	Phosphorylation	LDKFIEDYLLPDTCF HHHHHHHHCCCCHHH	9.43	27259358
42	Acetylation	DIICGFLKERCFRGS HHHHHHHHHHHCCCC	40.63	26051181
49	Phosphorylation	KERCFRGSSYPVCVS HHHHCCCCCCCEEEE	23.57	30108239
50	Phosphorylation	ERCFRGSSYPVCVSK HHHCCCCCCCEEEEE	35.96	26657352
50 (in isoform 3)	Phosphorylation	-	35.96	24719451
51	Phosphorylation	RCFRGSSYPVCVSKV HHCCCCCCCEEEEEE	11.03	23312004
116 (in isoform 3)	Phosphorylation	-	24.34	24719451
116	Phosphorylation	CQRERAFSVKFEVQA HHHHCCCEEEEEEEC	24.34	24719451
182	Ubiquitination	EECTDLQKEGEFSTC HHHCHHHHCCCHHHH	75.00	29967540
199	Ubiquitination	ELQRDFLKQRPTKLK HHHHHHHHHCCHHHH	44.23	29967540
207	Phosphorylation	QRPTKLKSLIRLVKH HCCHHHHHHHHHHHH	39.19	24719451
213	Ubiquitination	KSLIRLVKHWYQNCK HHHHHHHHHHHHHHH	32.77	29967540
220	Ubiquitination	KHWYQNCKKKLGKLP HHHHHHHHHHHCCCC	61.57	29967540
271	Phosphorylation	NYQQLCIYWTKYYDF CHHHHHHHHHHHCCC	13.16	18083107
279	Ubiquitination	WTKYYDFKNPIIEKY HHHHCCCCCHHHHHH	59.94	33845483
285	Ubiquitination	FKNPIIEKYLRRQLT CCCHHHHHHHHHHCC	38.89	33845483
314	Ubiquitination	NLGGGDPKGWRQLAQ CCCCCCHHHHHHHHH	75.69	29967540
338	Phosphorylation	CFKNWDGSPVSSWIL CCCCCCCCCCEEEEE	21.47	-
338 (in isoform 2)	Phosphorylation	-	21.47	25159151
341	Phosphorylation	NWDGSPVSSWILLAE CCCCCCCEEEEEEEE	24.28	23090842
342	Phosphorylation	WDGSPVSSWILLAES CCCCCCEEEEEEEEC	20.54	23090842
349	Phosphorylation	SWILLAESNSADDET EEEEEEECCCCCCCC	30.40	23090842
351	Phosphorylation	ILLAESNSADDETDD EEEEECCCCCCCCCC	42.21	23090842
356	Phosphorylation	SNSADDETDDPRRYQ CCCCCCCCCCHHHHH	53.34	23090842
362	Phosphorylation	ETDDPRRYQKYGYIG CCCCHHHHHHHCEEE	15.61	-
367	Phosphorylation	RRYQKYGYIGTHEYP HHHHHHCEEECCCCC	7.96	22461510

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OAS1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OAS1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OAS1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ANM6_HUMAN	PRMT6	physical	23455924
BUD23_HUMAN	WBSCR22	physical	21988832
RL30_HUMAN	RPL30	physical	21988832
TRI27_HUMAN	TRIM27	physical	25416956
EXOC5_HUMAN	EXOC5	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.