UniProt ID | NXT1_MOUSE | |
---|---|---|
UniProt AC | Q9QZV9 | |
Protein Name | NTF2-related export protein 1 | |
Gene Name | Nxt1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 140 | |
Subcellular Localization | Nucleus. Nucleus speckle. Cytoplasm. Shuttles between the nucleus and the cytoplasm. | |
Protein Description | Stimulator of protein export for NES-containing proteins. Also plays a role in the nuclear export of U1 snRNA, tRNA, and mRNA. The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with ALYREF/THOC4 and THOC5 (By similarity).. | |
Protein Sequence | MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDDATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MASVDFKTY ------CCCCCHHHH | 20.47 | - | |
120 | Phosphorylation | FILTAQASPSNTVWK EEEEEECCCCCHHHH | 19.44 | 26745281 | |
122 | Phosphorylation | LTAQASPSNTVWKIA EEEECCCCCHHHHHH | 42.51 | 26745281 | |
124 | Phosphorylation | AQASPSNTVWKIASD EECCCCCHHHHHHHH | 31.89 | 26745281 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NXT1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NXT1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NXT1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAN_HUMAN | RAN | physical | 10567585 | |
NXF1_MOUSE | Nxf1 | physical | 15820316 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...