NXT1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NXT1_MOUSE
• UniProt AC: Q9QZV9
• Protein Name: NTF2-related export protein 1
• Gene Name: Nxt1
• Organism: Mus musculus (Mouse).
• Sequence Length: 140
• Subcellular Localization: Nucleus. Nucleus speckle. Cytoplasm. Shuttles between the nucleus and the cytoplasm.
• Protein Description: Stimulator of protein export for NES-containing proteins. Also plays a role in the nuclear export of U1 snRNA, tRNA, and mRNA. The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with ALYREF/THOC4 and THOC5 (By similarity)..
• Protein Sequence: MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDDATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MASVDFKTY ------CCCCCHHHH	20.47	-
120	Phosphorylation	FILTAQASPSNTVWK EEEEEECCCCCHHHH	19.44	26745281
122	Phosphorylation	LTAQASPSNTVWKIA EEEECCCCCHHHHHH	42.51	26745281
124	Phosphorylation	AQASPSNTVWKIASD EECCCCCHHHHHHHH	31.89	26745281

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NXT1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NXT1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NXT1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RAN_HUMAN	RAN	physical	10567585
NXF1_MOUSE	Nxf1	physical	15820316

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.