| UniProt ID | NXF1_RAT | |
|---|---|---|
| UniProt AC | O88984 | |
| Protein Name | Nuclear RNA export factor 1 | |
| Gene Name | Nxf1 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 618 | |
| Subcellular Localization | Nucleus, nucleoplasm . Nucleus speckle . Cytoplasm . Nucleus . Localized predominantly in the nucleoplasm and at both the nucleoplasmic and cytoplasmic faces of the nuclear pore complex. Shuttles between the nucleus and the cytoplasm. Travels to the | |
| Protein Description | Involved in the nuclear export of mRNA species bearing retroviral constitutive transport elements (CTE) and in the export of mRNA from the nucleus to the cytoplasm (TAP/NFX1 pathway). The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with ALYREF/THOC4 and THOC5 components of the TREX complex. ALYREF/THOC4-bound mRNA is thought to be transferred to the NXF1-NXT1 heterodimer for export. Also involved in nuclear export of m6A-containing mRNAs: interaction between SRSF3 and YTHDC1 facilitates m6A-containing mRNA-binding to both SRSF3 and NXF1, promoting mRNA nuclear export.. | |
| Protein Sequence | MADEGKSYNEHDDRVSFPQRRKKGRGPFRWKCGVGNRRSGRGGSGIRSSRFEEDDGDVAMNDPQDGPRVRFNPYTTRPNRRRDTWHDRDRIHVTVRRDRAPQERGGAGTSQDGTTKNWFKITIPYGKKYDKMWLLSMIQSKCSVPFNPIEFHYENTRAHFFVENATTASALKAVNYKIQDRENGRISIIINSSAPPYIVQNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRGCMAAALRIIEENIPELLSLNLSNNRLYKLDDMSSIVQKAPNLKILNLSGNELKSEWELDKIKGLKLEELWLDRNPMCDTFLDQSTYISTIRERFPKLLRLDGHELPPPIAFDVEAPTMLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSTPSNPQNPVRHNLAKYFNDSRNVKKIKDTTTRFRLLKHTRLNVVAFLNELPKTHHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASPEEIQRAFAMPAPTPSSSPVPTLSQEQQDMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MADEGKSYN ------CCCCCCCCC | 24.46 | - | |
| 20 | Methylation | DRVSFPQRRKKGRGP CCCCCCHHHCCCCCC | 53.26 | 26494179 | |
| 41 | Asymmetric dimethylarginine | VGNRRSGRGGSGIRS CCCCCCCCCCCCCCC | 47.77 | - | |
| 41 | Methylation | VGNRRSGRGGSGIRS CCCCCCCCCCCCCCC | 47.77 | - | |
| 125 | Nitrated tyrosine | WFKITIPYGKKYDKM EEEEEEECCCCCCHH | 37.41 | - | |
| 125 | Nitration | WFKITIPYGKKYDKM EEEEEEECCCCCCHH | 37.41 | - | |
| 222 | Phosphorylation | MSKRYDGSQQALDLK HHHCCCCCCCCCCCC | 19.07 | 23984901 | |
| 298 | Phosphorylation | NLKILNLSGNELKSE CCEEEECCCCHHCCH | 38.20 | 23984901 | |
| 304 | Phosphorylation | LSGNELKSEWELDKI CCCCHHCCHHHHHHC | 61.64 | 23984901 | |
| 553 | Phosphorylation | AFAMPAPTPSSSPVP HHCCCCCCCCCCCCC | 37.60 | 27097102 | |
| 555 | Phosphorylation | AMPAPTPSSSPVPTL CCCCCCCCCCCCCCC | 46.02 | 27097102 | |
| 556 | Phosphorylation | MPAPTPSSSPVPTLS CCCCCCCCCCCCCCC | 39.60 | 27097102 | |
| 557 | Phosphorylation | PAPTPSSSPVPTLSQ CCCCCCCCCCCCCCH | 33.96 | 27097102 | |
| 561 | Phosphorylation | PSSSPVPTLSQEQQD CCCCCCCCCCHHHHH | 39.00 | 27097102 | |
| 563 | Phosphorylation | SSPVPTLSQEQQDML CCCCCCCCHHHHHHH | 33.86 | 27097102 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NXF1_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NXF1_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NXF1_RAT !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...