UniProt ID | NTF2_RAT | |
---|---|---|
UniProt AC | P61972 | |
Protein Name | Nuclear transport factor 2 {ECO:0000305} | |
Gene Name | Nutf2 {ECO:0000312|RGD:1359213} | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 127 | |
Subcellular Localization | Cytoplasm, cytosol . Nucleus outer membrane . Nucleus, nuclear pore complex . Nucleus inner membrane . Nucleus, nucleoplasm . At steady state it is essentially nucleoplasmic, enriched in nucleoplasmic foci. | |
Protein Description | Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import.. | |
Protein Sequence | MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Acetylation | ----MGDKPIWEQIG ----CCCCCHHHHHH | 32.45 | 25786129 | |
55 | Acetylation | GKAAIVEKLSSLPFQ CCHHHHHHHHCCCHH | 42.65 | 22902405 | |
55 | Ubiquitination | GKAAIVEKLSSLPFQ CCHHHHHHHHCCCHH | 42.65 | - | |
79 | Phosphorylation | DHQPTPDSCIISMVV CCCCCCCCEEEEEEE | 14.39 | 28689409 | |
80 | S-nitrosocysteine | HQPTPDSCIISMVVG CCCCCCCEEEEEEEE | 4.11 | - | |
80 | S-nitrosylation | HQPTPDSCIISMVVG CCCCCCCEEEEEEEE | 4.11 | 21278135 | |
83 | Phosphorylation | TPDSCIISMVVGQLK CCCCEEEEEEEECCC | 5.89 | 25575281 | |
114 | S-nitrosocysteine | NINDAWVCTNDMFRL CCCCEEEECHHHHHH | 1.73 | - | |
114 | S-nitrosylation | NINDAWVCTNDMFRL CCCCEEEECHHHHHH | 1.73 | 21278135 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NTF2_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NTF2_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NTF2_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...