dbPTM

NRK1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NRK1_HUMAN
UniProt AC	Q9NWW6
Protein Name	Nicotinamide riboside kinase 1
Gene Name	NMRK1
Organism	Homo sapiens (Human).
Sequence Length	199
Subcellular Localization
Protein Description	Catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN). The enzyme also phosphorylates the antitumor drugs tiazofurin and 3-deazaguanosine..
Protein Sequence	MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Ubiquitination	TLAKNLQKHLPNCSV HHHHHHHHHCCCCEE	50.72	-
76	Phosphorylation	AISCWMESARHSVVS HHHHHHHHHHCCCCC	17.94	17081983
134	Phosphorylation	RRRSTRVYQPPDSPG HHCCCCCCCCCCCCC	16.41	23090842
139	Phosphorylation	RVYQPPDSPGYFDGH CCCCCCCCCCCCCCC	26.46	29978859
142	Phosphorylation	QPPDSPGYFDGHVWP CCCCCCCCCCCCCHH	11.24	28857561
151	Phosphorylation	DGHVWPMYLKYRQEM CCCCHHHHHHHHHHH	8.93	29978859

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NRK1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NRK1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NRK1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NRK1_HUMAN

Related Literatures of Post-Translational Modification