dbPTM

NRIP3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NRIP3_HUMAN
UniProt AC	Q9NQ35
Protein Name	Nuclear receptor-interacting protein 3
Gene Name	NRIP3
Organism	Homo sapiens (Human).
Sequence Length	241
Subcellular Localization
Protein Description
Protein Sequence	MFYSGLLTEGGRKETDMREAASLRQQRRMKQAVQFIHKDSADLLPLDGLKKLGSSKDMQPHNILQRRLMETNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVKALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQTLRSLKCIINLDKHRLIMGKTDKEEIPFVETVSLNEDNTSEA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MFYSGLLTEG -----CCCCCCCCCC	10.67	28270605
4	Phosphorylation	----MFYSGLLTEGG ----CCCCCCCCCCC	16.23	28270605
8	Phosphorylation	MFYSGLLTEGGRKET CCCCCCCCCCCCCHH	37.31	28270605
15	Phosphorylation	TEGGRKETDMREAAS CCCCCCHHCHHHHHH	37.82	28270605
40	Phosphorylation	VQFIHKDSADLLPLD HHHHHHCCCCCCCCC	28.61	23898821
157	Phosphorylation	KHEGEKLSLPRHLKV CCCCCCCCCCHHHHH	47.60	24719451
177	Phosphorylation	HLVITLGSLRLDCPA EEEEECCCCCCCCCE	17.27	24719451
195	Phosphorylation	DDNEKNLSLGLQTLR CCCCCCHHHHHHHHH	29.77	-
200	Phosphorylation	NLSLGLQTLRSLKCI CHHHHHHHHHHHCEE	29.22	25690035
203	Phosphorylation	LGLQTLRSLKCIINL HHHHHHHHHCEEEEE	34.98	28450419

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NRIP3_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NRIP3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NRIP3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KASH5_HUMAN	CCDC155	physical	25416956
DDI2_HUMAN	DDI2	physical	28514442
PSMG2_HUMAN	PSMG2	physical	28514442

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NRIP3_HUMAN

Related Literatures of Post-Translational Modification