UniProt ID | NPNT_HUMAN | |
---|---|---|
UniProt AC | Q6UXI9 | |
Protein Name | Nephronectin | |
Gene Name | NPNT | |
Organism | Homo sapiens (Human). | |
Sequence Length | 565 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix. Trapped on the cell surface or in the extracellular matrix.. | |
Protein Description | Functional ligand of integrin alpha-8/beta-1 in kidney development. Regulates the expression of GDNF with integrin alpha-8/beta-1 which is essential for kidney development. May also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins (By similarity).. | |
Protein Sequence | MDFLLALVLVSSLYLQAAAEFDGRWPRQIVSSIGLCRYGGRIDCCWGWARQSWGQCQPVCQPRCKHGECIGPNKCKCHPGYAGKTCNQDLNECGLKPRPCKHRCMNTYGSYKCYCLNGYMLMPDGSCSSALTCSMANCQYGCDVVKGQIRCQCPSPGLQLAPDGRTCVDVDECATGRASCPRFRQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDECSLGQYQCSSFARCYNIRGSYKCKCKEGYQGDGLTCVYIPKVMIEPSGPIHVPKGNGTILKGDTGNNNWIPDVGSTWWPPKTPYIPPIITNRPTSKPTTRPTPKPTPIPTPPPPPPLPTELRTPLPPTTPERPTTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFEIERGVSADDEAKDDPGVLVHSCNFDHGLCGWIREKDNDLHWEPIRDPAGGQYLTVSAAKAPGGKAARLVLPLGRLMHSGDLCLSFRHKVTGLHSGTLQVFVRKHGAHGAALWGRNGGHGWRQTQITLRGADIKSVVFKGEKRRGHTGEIGLDDVSLKKGHCSEER | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | LLALVLVSSLYLQAA HHHHHHHHHHHHHHH | 15.51 | 24043423 | |
12 | Phosphorylation | LALVLVSSLYLQAAA HHHHHHHHHHHHHHH | 17.35 | 24043423 | |
14 | Phosphorylation | LVLVSSLYLQAAAEF HHHHHHHHHHHHHHC | 9.94 | 24043423 | |
74 | Ubiquitination | GECIGPNKCKCHPGY CCEECCCCCCCCCCC | 37.90 | 29967540 | |
91 | Ubiquitination | KTCNQDLNECGLKPR CCCCCCHHHCCCCCC | 51.29 | 29967540 | |
96 | Ubiquitination | DLNECGLKPRPCKHR CHHHCCCCCCCCCCC | 25.02 | 29967540 | |
96 | Methylation | DLNECGLKPRPCKHR CHHHCCCCCCCCCCC | 25.02 | 23644510 | |
96 | Trimethylation | DLNECGLKPRPCKHR CHHHCCCCCCCCCCC | 25.02 | - | |
113 | Ubiquitination | NTYGSYKCYCLNGYM CCCCCCEEEEECCEE | 1.89 | 29967540 | |
114 | Phosphorylation | TYGSYKCYCLNGYML CCCCCEEEEECCEEE | 8.88 | 24043423 | |
119 | Phosphorylation | KCYCLNGYMLMPDGS EEEEECCEEECCCCC | 5.99 | 24043423 | |
126 | Phosphorylation | YMLMPDGSCSSALTC EEECCCCCCCCCHHH | 20.43 | 24043423 | |
128 | Phosphorylation | LMPDGSCSSALTCSM ECCCCCCCCCHHHHH | 21.97 | 24043423 | |
129 | Phosphorylation | MPDGSCSSALTCSMA CCCCCCCCCHHHHHC | 31.46 | 24043423 | |
132 | Phosphorylation | GSCSSALTCSMANCQ CCCCCCHHHHHCCCC | 11.40 | 24043423 | |
134 | Phosphorylation | CSSALTCSMANCQYG CCCCHHHHHCCCCCC | 18.72 | 24043423 | |
140 | Phosphorylation | CSMANCQYGCDVVKG HHHCCCCCCCCEECC | 23.17 | 24043423 | |
189 | Phosphorylation | RFRQCVNTFGSYICK HHHHHHHHHHHHHHH | 14.69 | 24719451 | |
205 | Phosphorylation | HKGFDLMYIGGKYQC CCCCCEEEECCEEEE | 12.05 | 24719451 | |
223 | Phosphorylation | DECSLGQYQCSSFAR CCCCCCEEECCCCCH | 15.08 | - | |
226 | Phosphorylation | SLGQYQCSSFARCYN CCCEEECCCCCHHEE | 16.99 | - | |
227 | Phosphorylation | LGQYQCSSFARCYNI CCEEECCCCCHHEEC | 30.47 | - | |
258 | Ubiquitination | LTCVYIPKVMIEPSG EEEEEECCEEEECCC | 34.57 | 29967540 | |
264 | O-linked_Glycosylation | PKVMIEPSGPIHVPK CCEEEECCCCEECCC | 44.40 | 55832555 | |
275 | Ubiquitination | HVPKGNGTILKGDTG ECCCCCCEEEECCCC | 27.43 | 29967540 | |
288 | Ubiquitination | TGNNNWIPDVGSTWW CCCCCCCCCCCCCCC | 23.11 | 29967540 | |
327 | O-linked_Glycosylation | PKPTPIPTPPPPPPL CCCCCCCCCCCCCCC | 49.50 | OGP | |
336 | Phosphorylation | PPPPPLPTELRTPLP CCCCCCCCCCCCCCC | 56.16 | 24719451 | |
362 | O-linked_Glycosylation | TTIAPAASTPPGGIT CEEECCCCCCCCCEE | 43.48 | OGP | |
363 | O-linked_Glycosylation | TIAPAASTPPGGITV EEECCCCCCCCCEEE | 28.86 | OGP | |
376 | O-linked_Glycosylation | TVDNRVQTDPQKPRG EECCCEECCCCCCCC | 46.95 | 55830883 | |
380 | Ubiquitination | RVQTDPQKPRGDVFI CEECCCCCCCCCEEC | 41.91 | 29967540 | |
392 | Phosphorylation | VFIPRQPSNDLFEIF EECCCCCCCCCEEEE | 34.34 | 24719451 | |
397 | Ubiquitination | QPSNDLFEIFEIERG CCCCCCEEEEEEECC | 54.81 | 29967540 | |
410 | Ubiquitination | RGVSADDEAKDDPGV CCCCCCCCCCCCCCE | 59.16 | 29967540 | |
422 | Phosphorylation | PGVLVHSCNFDHGLC CCEEEEECCCCCCCC | 3.38 | 24719451 | |
430 | Ubiquitination | NFDHGLCGWIREKDN CCCCCCCHHHEECCC | 28.08 | 29967540 | |
459 | Ubiquitination | YLTVSAAKAPGGKAA EEEEEEECCCCCHHH | 55.63 | 29967540 | |
460 | Ubiquitination | LTVSAAKAPGGKAAR EEEEEECCCCCHHHE | 11.84 | 29967540 | |
476 | Ubiquitination | VLPLGRLMHSGDLCL EEEHHHHHHCCCEEE | 1.97 | 29967540 | |
489 | Ubiquitination | CLSFRHKVTGLHSGT EEEEEEECCCCCCCE | 4.13 | 29967540 | |
528 | Ubiquitination | RQTQITLRGADIKSV EEEEEEECCCCEEEE | 29.60 | 29967540 | |
557 | Ubiquitination | GLDDVSLKKGHCSEE CCCCCCCCCCCCCCC | 49.56 | 29967540 | |
558 | Ubiquitination | LDDVSLKKGHCSEER CCCCCCCCCCCCCCC | 60.21 | 29967540 | |
574 | Ubiquitination | ---------------- ---------------- | 29967540 | ||
587 | Ubiquitination | ----------------------------- ----------------------------- | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NPNT_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NPNT_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NPNT_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ITA8_HUMAN | ITGA8 | physical | 11470831 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...