NNAT_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NNAT_HUMAN
• UniProt AC: Q16517
• Protein Name: Neuronatin
• Gene Name: NNAT
• Organism: Homo sapiens (Human).
• Sequence Length: 81
• Protein Description: May participate in the maintenance of segment identity in the hindbrain and pituitary development, and maturation or maintenance of the overall structure of the nervous system. May function as a regulatory subunit of ion channels..
• Protein Sequence: MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MAAVAAASAELLIIG CHHHHHHHHHHHHHH	19.97	22210691
28 (in isoform 2)	Phosphorylation	-	18.84	29514088
29 (in isoform 2)	Phosphorylation	-	1.54	29514088
50	Phosphorylation	GTQPIARSEVFRYSL CCCCCCHHHHHHHHH	29.14	24117733
55	Phosphorylation	ARSEVFRYSLQKLAY CHHHHHHHHHHHHHH	11.41	24117733
56	Phosphorylation	RSEVFRYSLQKLAYT HHHHHHHHHHHHHHH	21.77	24117733

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NNAT_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NNAT_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NNAT_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NHLC1_HUMAN	NHLRC1	physical	21742036
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.