| UniProt ID | NMB_HUMAN | |
|---|---|---|
| UniProt AC | P08949 | |
| Protein Name | Neuromedin-B | |
| Gene Name | NMB | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 121 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Stimulates smooth muscle contraction in a manner similar to that of bombesin.. | |
| Protein Sequence | MARRAGGARMFGSLLLFALLAAGVAPLSWDLPEPRSRASKIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTAPHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 52 | O-linked_Glycosylation | SRGNLWATGHFMGKK CCCCEEECCCCCCCC | 21.43 | 55827079 | |
| 56 | Methionine amide | LWATGHFMGKKSLEP EEECCCCCCCCCCCC | 6.80 | - | |
| 56 | Amidation | LWATGHFMGKKSLEP EEECCCCCCCCCCCC | 6.80 | 2458345 | |
| 56 | Methylation | LWATGHFMGKKSLEP EEECCCCCCCCCCCC | 6.80 | 2458345 | |
| 60 | O-linked_Glycosylation | GHFMGKKSLEPSSPS CCCCCCCCCCCCCCC | 41.26 | 55826689 | |
| 64 | O-linked_Glycosylation | GKKSLEPSSPSPLGT CCCCCCCCCCCCCCC | 45.57 | 55826695 | |
| 65 | O-linked_Glycosylation | KKSLEPSSPSPLGTA CCCCCCCCCCCCCCC | 39.86 | 55826699 | |
| 67 | O-linked_Glycosylation | SLEPSSPSPLGTAPH CCCCCCCCCCCCCCC | 34.40 | 55826705 | |
| 71 | O-linked_Glycosylation | SSPSPLGTAPHTSLR CCCCCCCCCCCCCHH | 44.70 | 55826711 | |
| 75 | O-linked_Glycosylation | PLGTAPHTSLRDQRL CCCCCCCCCHHHHHH | 28.53 | 55826717 | |
| 76 | O-linked_Glycosylation | LGTAPHTSLRDQRLQ CCCCCCCCHHHHHHH | 20.55 | 55826721 | |
| 103 | Phosphorylation | KALGVSLSRPAPQIQ HHHCCCCCCCCCHHH | 28.81 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NMB_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NMB_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NMB_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NMBR_HUMAN | NMBR | physical | 8392057 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
