NKX32_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NKX32_MOUSE
• UniProt AC: P97503
• Protein Name: Homeobox protein Nkx-3.2
• Gene Name: Nkx3-2
• Organism: Mus musculus (Mouse).
• Sequence Length: 333
• Subcellular Localization: Nucleus .
• Protein Description: Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus..
• Protein Sequence: MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
73	Phosphorylation	AEDSLLASPARTRTA CCHHHCCCCCCCCCC	21.04	26824392
146	Phosphorylation	EEEAPVRSDSEMSAS HHHCCCCCCCCCEEE	45.80	24224561
148	Phosphorylation	EAPVRSDSEMSASVS HCCCCCCCCCEEECC	36.12	21606193
159	Phosphorylation	ASVSGDHSPRGEDDS EECCCCCCCCCCCCC	22.49	24224561
168	Phosphorylation	RGEDDSVSPGGARVP CCCCCCCCCCCCCCC	23.06	21606193

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
146	S	Phosphorylation	Kinase	IKKB	O14920	PSP
148	S	Phosphorylation	Kinase	IKKB	O14920	PSP
168	S	Phosphorylation	Kinase	IKKB	O14920	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NKX32_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NKX32_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IKKB_MOUSE	Ikbkb	physical	21606193
NEMO_MOUSE	Ikbkg	physical	21606193
FBW1A_MOUSE	Btrc	physical	21606193

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.