| UniProt ID | NKX22_HUMAN | |
|---|---|---|
| UniProt AC | O95096 | |
| Protein Name | Homeobox protein Nkx-2.2 | |
| Gene Name | NKX2-2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 273 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Acts as a transcriptional activator. Required for the maintenance of NEUROD1 expression in the horomone-producing endocrine cells of the pancreas. May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Associates with chromatin at the NEUROD1 promoter region. Binds to a subset of consensus elements within the NEUROD1 promoter (By similarity).. | |
| Protein Sequence | MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MSLTNTKTGFSVK --CCCCCCCCCCCHH | 25.42 | - | |
| 8 | Phosphorylation | MSLTNTKTGFSVKDI CCCCCCCCCCCHHHH | 41.23 | - | |
| 11 | Phosphorylation | TNTKTGFSVKDILDL CCCCCCCCHHHHHCC | 29.60 | - | |
| 58 | Phosphorylation | GALDAVQSLPLKNPF CHHHHHHCCCCCCCC | 25.92 | - | |
| 136 | Phosphorylation | RKRRVLFSKAQTYEL HHHHHHHHHHHHHHH | 23.95 | 24719451 | |
| 137 | Ubiquitination | KRRVLFSKAQTYELE HHHHHHHHHHHHHHH | 36.86 | 29967540 | |
| 152 | Phosphorylation | RRFRQQRYLSAPERE HHHHHHHHCCCCCHH | 10.73 | 24719451 | |
| 163 | Phosphorylation | PEREHLASLIRLTPT CCHHHHHHHHHHCHH | 30.59 | 24719451 | |
| 195 | Phosphorylation | AEKGMEVTPLPSPRR HHCCCCCCCCCCCCE | 13.05 | 29523821 | |
| 199 | Phosphorylation | MEVTPLPSPRRVAVP CCCCCCCCCCEEEEE | 38.43 | 25850435 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NKX22_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NKX22_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NKX22_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SIN3A_HUMAN | SIN3A | physical | 15695521 | |
| HDAC1_HUMAN | HDAC1 | physical | 15695521 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
